FC876220

Overview
NameFC876220
Unique NameFC876220
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length716
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:8..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSB_PETHY (Chalcone synthase B OS=Petunia hybrida GN=CHSB PE=2 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 4.035e-84
Identity = 126/173 (72.83%), Postives = 152/173 (87.86%), Query Frame = 3
Query:   78 AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            AQRA+GPA +LAIGTATP H V+Q  YPDYYFR+T S+H+ +LKEKF+R+C K+MIKKR+++LTEE+L++NP +C++  PSLD RQDI+V E+PKLGKEAA KAI EWGQPKS ITHL+FCT SGVDMPGAD QL KL+GL PSV+R MMYQQGCFAGGT+LRLAKDLAENN+
Sbjct:   13 AQRAEGPAKILAIGTATPFHWVDQNSYPDYYFRVTNSQHLVDLKEKFRRICSKTMIKKRHMFLTEELLRKNPTLCSHNEPSLDIRQDILVSEIPKLGKEAALKAIGEWGQPKSTITHLVFCTRSGVDMPGADCQLVKLLGLSPSVQRLMMYQQGCFAGGTMLRLAKDLAENNK 185          

HSP 2 Score: 60.077 bits (144), Expect = 4.035e-84
Identity = 26/41 (63.41%), Postives = 37/41 (90.24%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVC+E +A+ FRGP++ ++D+L+ QALFGDGAAA+
Sbjct:  185 KGARVLVVCAESSAIGFRGPSEANVDNLIAQALFGDGAAAL 225          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: DPS2_PINST (Pinosylvin synthase 2 OS=Pinus strobus GN=STS2 PE=2 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 1.395e-81
Identity = 120/180 (66.67%), Postives = 153/180 (85.00%), Query Frame = 3
Query:   60 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYM-APSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            ++  R +QRADG A++LAIGTA P + V+Q+ YPDYYFR T +E  T+LK+KFKR+C++S IKKR++YLTEEILK+NP +CA++  PSLD RQ ++ VEVP+LGKEAA KAI+EWGQPKS+ITHLIFCTT+  D+PGAD+++ KL+GL PSVKR  ++Q GCFAGGTVLRLAKDLAENNR
Sbjct:    9 LEAFRKSQRADGFASILAIGTANPPNVVDQSTYPDYYFRNTNNEDNTDLKDKFKRICERSAIKKRHMYLTEEILKKNPELCAFLEVPSLDTRQAMLAVEVPRLGKEAAEKAIEEWGQPKSRITHLIFCTTTTPDLPGADFEVAKLLGLHPSVKRVGVFQHGCFAGGTVLRLAKDLAENNR 188          

HSP 2 Score: 70.8626 bits (172), Expect = 1.395e-81
Identity = 34/41 (82.93%), Postives = 38/41 (92.68%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE TAVTFRGP++THLD LVG ALFGDGAAA+
Sbjct:  188 RGARVLVVCSENTAVTFRGPSETHLDGLVGLALFGDGAAAL 228          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: DPS1_PINST (Pinosylvin synthase 1 OS=Pinus strobus GN=STS1 PE=1 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 1.820e-81
Identity = 119/180 (66.11%), Postives = 153/180 (85.00%), Query Frame = 3
Query:   60 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYM-APSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            ++  R +QRADG A++LAIGTA P + V+Q+ YPDYYFR+T +E  T+LK+KFKR+C++S IKKR++YLTEEILK+NP +CA++  PSLD RQ ++  EVP+LGKEAA KAI+EWGQPKS+ITHLIFCTT+  D+PGAD+++ KL+GL PSVKR  ++Q GCFAGGTVLRLAKDLAENNR
Sbjct:    9 LEAFRKSQRADGFASILAIGTANPPNVVDQSTYPDYYFRVTNNEDNTDLKDKFKRICERSAIKKRHMYLTEEILKKNPELCAFLEVPSLDTRQAMLAAEVPRLGKEAAEKAIEEWGQPKSRITHLIFCTTTTPDLPGADFEVAKLLGLHPSVKRVGVFQHGCFAGGTVLRLAKDLAENNR 188          

HSP 2 Score: 69.707 bits (169), Expect = 1.820e-81
Identity = 33/41 (80.49%), Postives = 38/41 (92.68%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE TAVTFRGP++THLD LVG ALFGDGA+A+
Sbjct:  188 RGARVLVVCSENTAVTFRGPSETHLDGLVGLALFGDGASAL 228          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: DPSS_PINSY (Dihydropinosylvin synthase OS=Pinus sylvestris PE=1 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 2.374e-81
Identity = 118/176 (67.05%), Postives = 152/176 (86.36%), Query Frame = 3
Query:   72 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYM-APSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            R  QRADG A++LAIGTA P ++V+Q+ YPD+YFRIT +EH TELK+KFKR+C++S IK+RY+YLTEEILK+NP++CA++  PSLDARQ ++ +EVP+L KEAA KAI+EWGQ KS ITHLIFC+T+  D+PGAD+++ KL+GL PSVKR  ++Q GCFAGGTVLR+AKDLAENNR
Sbjct:   10 RKLQRADGFASILAIGTANPPNAVDQSTYPDFYFRITGNEHNTELKDKFKRICERSAIKQRYMYLTEEILKKNPDVCAFVEVPSLDARQAMLAMEVPRLAKEAAEKAIQEWGQSKSGITHLIFCSTTTPDLPGADFEVAKLLGLHPSVKRVGVFQHGCFAGGTVLRMAKDLAENNR 185          

HSP 2 Score: 74.3294 bits (181), Expect = 2.374e-81
Identity = 34/41 (82.93%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLV+CSE TAVTFRGP++THLDSLVGQALFGDGA+A+
Sbjct:  185 RGARVLVICSETTAVTFRGPSETHLDSLVGQALFGDGASAL 225          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_PERAE (Chalcone synthase OS=Persea americana GN=CHS PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 1.821e-78
Identity = 120/183 (65.57%), Postives = 138/183 (75.41%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYY-FRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M  V+ IR  QRA+GPAT++AIGT+TP ++V+Q++YPDYY F    +      +  FKRMC+KSMIKKRY+YLTE   K            L ARQD+VVVEVPKLGKE   KAIK  GQPKSKI  L+FCTTSGVDMPGADYQLTK+ GL PSVKR MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVNVEAIRKVQRAEGPATIMAIGTSTPPNAVDQSEYPDYYYFGSPTASTRPSSRRSFKRMCEKSMIKKRYMYLTETYWKRIQMFVPTWLLPLKARQDMVVVEVPKLGKEVQPKAIKGMGQPKSKINPLVFCTTSGVDMPGADYQLTKVFGLPPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 183          

HSP 2 Score: 79.337 bits (194), Expect = 1.821e-78
Identity = 38/41 (92.68%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  183 KGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAL 223          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSA_IPOPL (Chalcone synthase A (Fragment) OS=Ipomoea platensis GN=CHSA PE=2 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.526e-77
Identity = 122/175 (69.71%), Postives = 148/175 (84.57%), Query Frame = 3
Query:   72 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            R A+R +G A +LA+GTATPA+ V+Q  YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR++ LTEE+LK+NPN+C Y   SL+ RQD +V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAENN+
Sbjct:   12 RRAKRFEGHAKILAVGTATPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKRHLVLTEELLKKNPNLCTYNETSLNTRQDTLVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNISVKRLMMYQQGCNAGAAMLRLAKDLAENNK 186          

HSP 2 Score: 54.6842 bits (130), Expect = 1.526e-77
Identity = 26/41 (63.41%), Postives = 32/41 (78.05%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+T   FRGP+    D+L+ Q LFGDG+AAV
Sbjct:  186 KGARVLVVCSEVTLSVFRGPSLQQEDNLLAQCLFGDGSAAV 226          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSB_IPOPU (Chalcone synthase B OS=Ipomoea purpurea GN=CHSB PE=3 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.665e-76
Identity = 122/175 (69.71%), Postives = 148/175 (84.57%), Query Frame = 3
Query:   72 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            R A+R +G A +LAIGTATPA  V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I+KR++ LTEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAE+N+
Sbjct:   14 RRAKRLEGDAKILAIGTATPASWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIRKRHLVLTEELLKKNPNLCTYNETSLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAESNK 188          

HSP 2 Score: 51.2174 bits (121), Expect = 1.665e-76
Identity = 25/41 (60.98%), Postives = 31/41 (75.61%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +G RVLVVC+EIT   FRGP+    D+L+ Q LFGDGAAA+
Sbjct:  188 KGGRVLVVCAEITINIFRGPSLEQDDNLLAQCLFGDGAAAM 228          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSA_IPOPU (Chalcone synthase A OS=Ipomoea purpurea GN=CHSA PE=3 SV=2)

HSP 1 Score: 255.373 bits (651), Expect = 2.172e-76
Identity = 121/173 (69.94%), Postives = 147/173 (84.97%), Query Frame = 3
Query:   78 AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            A+R +G A +LAIGTATPA+ V+Q  YPD+YFRIT SEH+ E KEKF+R+C+KS I KR++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGK+AA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAENN+
Sbjct:   16 AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIMKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKDAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNK 188          

HSP 2 Score: 51.9878 bits (123), Expect = 2.172e-76
Identity = 25/41 (60.98%), Postives = 30/41 (73.17%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +G RVLVVCSE+    FRGP+    D+L+ Q LFGDGAAAV
Sbjct:  188 KGGRVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGAAAV 228          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSA_IPOTF (Chalcone synthase A (Fragment) OS=Ipomoea trifida GN=CHSA PE=3 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 3.697e-76
Identity = 125/182 (68.68%), Postives = 152/182 (83.52%), Query Frame = 3
Query:   54 ATVQEIRN-AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            ATVQ   + A+R +G A +LAIGTATP + V+QA YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR++ LT+E+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRL KDLAENN+
Sbjct:    5 ATVQLTDDTAKRFEGHAKLLAIGTATPTNWVDQATYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKRHLVLTKELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLVKDLAENNK 186          

HSP 2 Score: 52.7582 bits (125), Expect = 3.697e-76
Identity = 26/41 (63.41%), Postives = 32/41 (78.05%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEIT   FRGP+    D+L+ Q LFGDG+AA+
Sbjct:  186 KGARVLVVCSEITINIFRGPSLEQDDNLLAQCLFGDGSAAM 226          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSB_IPOCO (Chalcone synthase B (Fragment) OS=Ipomoea cordatotriloba GN=CHSB PE=3 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.395e-75
Identity = 120/175 (68.57%), Postives = 148/175 (84.57%), Query Frame = 3
Query:   72 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            R  +R +G A +LAIGTATPA+ V+Q  YPD+YFRIT S+H+ + KEKF+R+C+KS I+KR++ LTEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKD+AENN+
Sbjct:   14 RREKRFEGHAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLDHKEKFRRICNKSKIRKRHMILTEELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDVAENNK 188          

HSP 2 Score: 51.2174 bits (121), Expect = 1.395e-75
Identity = 24/41 (58.54%), Postives = 31/41 (75.61%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+    FRGP+    D+L+ Q LFGDG+AA+
Sbjct:  188 KGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAL 228          
The following BLAST results are available for this feature:
BLAST of FC876220 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSB_PETHY4.035e-8472.83Chalcone synthase B OS=Petunia hybrida GN=CHSB PE=... [more]
DPS2_PINST1.395e-8166.67Pinosylvin synthase 2 OS=Pinus strobus GN=STS2 PE=... [more]
DPS1_PINST1.820e-8166.11Pinosylvin synthase 1 OS=Pinus strobus GN=STS1 PE=... [more]
DPSS_PINSY2.374e-8167.05Dihydropinosylvin synthase OS=Pinus sylvestris PE=... [more]
CHSY_PERAE1.821e-7865.57Chalcone synthase OS=Persea americana GN=CHS PE=2 ... [more]
CHSA_IPOPL1.526e-7769.71Chalcone synthase A (Fragment) OS=Ipomoea platensi... [more]
CHSB_IPOPU1.665e-7669.71Chalcone synthase B OS=Ipomoea purpurea GN=CHSB PE... [more]
CHSA_IPOPU2.172e-7669.94Chalcone synthase A OS=Ipomoea purpurea GN=CHSA PE... [more]
CHSA_IPOTF3.697e-7668.68Chalcone synthase A (Fragment) OS=Ipomoea trifida ... [more]
CHSB_IPOCO1.395e-7568.57Chalcone synthase B (Fragment) OS=Ipomoea cordatot... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H05EF DevOvary1 Citrus clementina cDNA clone C32001H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876220 ID=FC876220|Name=FC876220|organism=Citrus clementina|type=EST|length=716bp
AACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGAA
ATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGC
CACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAGG
CTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACG
GAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGAA
GCGTTACATATACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGT
GCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGGTC
GAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAATG
GGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCCG
GCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCTG
CGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCGG
CGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGCGC
TCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGGCC
CTGCCGATACTCATCTTGATTCTCTTGTGGGCCAGGCTTTGTTCGGTGAT
GGTGCTGCTGCTGTGA
back to top