FC876220

Overview
NameFC876220
Unique NameFC876220
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length716
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:8..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_PINST (Chalcone synthase OS=Pinus strobus GN=CHS PE=2 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 1.237e-103
Identity = 153/182 (84.07%), Postives = 171/182 (93.96%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            MA ++  R AQRADGPAT+LAIGTATP ++V+Q+ YPDYYF+IT SEHMTELKEKF+RMCDKS IKKRY+YLTEEIL ENP++CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITH+IFCTTSGVDMPGADYQ+TKL+GLRPSVKR MMYQQGCFAGGTVLR+AKDLAENNR
Sbjct:    6 MADLEAFRKAQRADGPATILAIGTATPPNAVDQSTYPDYYFKITNSEHMTELKEKFRRMCDKSGIKKRYMYLTEEILNENPSVCAYMAPSLDARQDMVVVEVPRLGKEAAAKAIKEWGQPKSKITHVIFCTTSGVDMPGADYQMTKLLGLRPSVKRVMMYQQGCFAGGTVLRVAKDLAENNR 187          

HSP 2 Score: 76.6406 bits (187), Expect = 1.237e-103
Identity = 36/41 (87.80%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDS+VGQALFGDGA A+
Sbjct:  187 RGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDGARAL 227          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS8_BROFI (Chalcone synthase 8 OS=Bromheadia finlaysoniana GN=CHS8 PE=2 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 1.237e-103
Identity = 152/178 (85.39%), Postives = 169/178 (94.94%), Query Frame = 3
Query:   60 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            ++EIR AQRA+GPA VLAIGT+TP +++ QADYPDYYFRITKSEH+TELKEKFKRMCDKSMIKKRY+YLTEEILKENPN+CA+MAPSLDARQDIVV EVPKL KEAA +AIKEWG PKS+ITHLIFCTTSG+DMPGADYQLT+L+GLRPSV RFM+YQQGCFAGGTVLRLAKDLAENN
Sbjct:    5 MEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNICAFMAPSLDARQDIVVTEVPKLAKEAAARAIKEWGHPKSRITHLIFCTTSGIDMPGADYQLTRLLGLRPSVNRFMLYQQGCFAGGTVLRLAKDLAENN 182          

HSP 2 Score: 76.6406 bits (187), Expect = 1.237e-103
Identity = 36/40 (90.00%), Postives = 40/40 (100.00%), Query Frame = 2
Query:  596 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            GARVLVVCSEITAVTFRGP+++HLDSLVGQALFGDGAAA+
Sbjct:  184 GARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAI 223          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS4_BROFI (Chalcone synthase 4 OS=Bromheadia finlaysoniana GN=CHS4 PE=2 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 1.237e-103
Identity = 152/178 (85.39%), Postives = 169/178 (94.94%), Query Frame = 3
Query:   60 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            ++EIR AQRA+GPA VLAIGT+TP +++ QADYPDYYFRITKSEH+TELKEKFKRMCDKSMIKKRY+YLTEEILKENPN+CA+MAPSLDARQDIVV EVPKL KEAA +AIKEWG PKS+ITHLIFCTTSG+DMPGADYQLT+L+GLRPSV RFM+YQQGCFAGGTVLRLAKDLAENN
Sbjct:    5 MEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNICAFMAPSLDARQDIVVTEVPKLAKEAAVRAIKEWGHPKSRITHLIFCTTSGIDMPGADYQLTRLLGLRPSVNRFMLYQQGCFAGGTVLRLAKDLAENN 182          

HSP 2 Score: 76.6406 bits (187), Expect = 1.237e-103
Identity = 36/40 (90.00%), Postives = 40/40 (100.00%), Query Frame = 2
Query:  596 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            GARVLVVCSEITAVTFRGP+++HLDSLVGQALFGDGAAA+
Sbjct:  184 GARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAI 223          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS3_BROFI (Chalcone synthase 3 OS=Bromheadia finlaysoniana GN=CHS3 PE=2 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 1.237e-103
Identity = 152/178 (85.39%), Postives = 169/178 (94.94%), Query Frame = 3
Query:   60 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            ++EIR AQRA+GPA VLAIGT+TP +++ QADYPDYYFRITKSEH+TELKEKFKRMCDKSMIKKRY+YLTEEILKENPN+CA+MAPSLDARQDIVV EVPKL KEAA +AIKEWG PKS+ITHLIFCTTSG+DMPGADYQLT+L+GLRPSV RFM+YQQGCFAGGTVLRLAKDLAENN
Sbjct:    5 MEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNICAFMAPSLDARQDIVVTEVPKLAKEAAVRAIKEWGHPKSRITHLIFCTTSGIDMPGADYQLTRLLGLRPSVNRFMLYQQGCFAGGTVLRLAKDLAENN 182          

HSP 2 Score: 76.6406 bits (187), Expect = 1.237e-103
Identity = 36/40 (90.00%), Postives = 40/40 (100.00%), Query Frame = 2
Query:  596 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            GARVLVVCSEITAVTFRGP+++HLDSLVGQALFGDGAAA+
Sbjct:  184 GARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAI 223          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS5_PEA (Chalcone synthase 5 OS=Pisum sativum GN=CHS5 PE=3 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 1.238e-103
Identity = 152/182 (83.52%), Postives = 169/182 (92.86%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YFRIT SEH TELK+KF+RMCDKSMI +RY+YLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFRITNSEHKTELKQKFQRMCDKSMINRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 78.9518 bits (193), Expect = 1.238e-103
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+TAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS3_PEA (Chalcone synthase 3 OS=Pisum sativum GN=CHS3 PE=3 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 1.238e-103
Identity = 152/182 (83.52%), Postives = 169/182 (92.86%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YFRIT SEH TELK+KF+RMCDKSMI +RY+YLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFRITNSEHKTELKQKFQRMCDKSMINRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 78.9518 bits (193), Expect = 1.238e-103
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+TAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS2_IPOBA (Chalcone synthase LF2 OS=Ipomoea batatas GN=CHS-LF2 PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 1.615e-103
Identity = 153/182 (84.07%), Postives = 167/182 (91.76%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV+E+R AQRA+GPAT+LAIGT TPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRY++LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GL PSVKR MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLSPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 77.0258 bits (188), Expect = 1.615e-103
Identity = 36/41 (87.80%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVL+VCSEIT VTFRGP++THLDSLVGQALFGDGAAAV
Sbjct:  182 KGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS9_MEDSA (Chalcone synthase 9 OS=Medicago sativa GN=CHS9 PE=2 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.107e-103
Identity = 151/182 (82.97%), Postives = 169/182 (92.86%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIR AQRA+GPAT++AIGTA PA+ V Q+ YPD+YF+IT SEH  ELKEKF+RMCDKSMIK+RY+YLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVSEIRQAQRAEGPATIMAIGTANPANCVEQSTYPDFYFKITNSEHKVELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 78.9518 bits (193), Expect = 2.107e-103
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+TAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS8_MEDSA (Chalcone synthase 8 OS=Medicago sativa GN=CHS8 PE=2 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.107e-103
Identity = 152/182 (83.52%), Postives = 169/182 (92.86%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH TELKEKF+RMCDKSMIK+RY+YLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVSEIRTAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 78.9518 bits (193), Expect = 2.107e-103
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+TAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS4_MEDSA (Chalcone synthase 4 OS=Medicago sativa GN=CHS4 PE=2 SV=2)

HSP 1 Score: 318.546 bits (815), Expect = 2.107e-103
Identity = 152/182 (83.52%), Postives = 169/182 (92.86%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH TELKEKF+RMCDKSMIK+RY+YLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 78.9518 bits (193), Expect = 2.107e-103
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+TAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
The following BLAST results are available for this feature:
BLAST of FC876220 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSY_PINST1.237e-10384.07Chalcone synthase OS=Pinus strobus GN=CHS PE=2 SV=... [more]
CHS8_BROFI1.237e-10385.39Chalcone synthase 8 OS=Bromheadia finlaysoniana GN... [more]
CHS4_BROFI1.237e-10385.39Chalcone synthase 4 OS=Bromheadia finlaysoniana GN... [more]
CHS3_BROFI1.237e-10385.39Chalcone synthase 3 OS=Bromheadia finlaysoniana GN... [more]
CHS5_PEA1.238e-10383.52Chalcone synthase 5 OS=Pisum sativum GN=CHS5 PE=3 ... [more]
CHS3_PEA1.238e-10383.52Chalcone synthase 3 OS=Pisum sativum GN=CHS3 PE=3 ... [more]
CHS2_IPOBA1.615e-10384.07Chalcone synthase LF2 OS=Ipomoea batatas GN=CHS-LF... [more]
CHS9_MEDSA2.107e-10382.97Chalcone synthase 9 OS=Medicago sativa GN=CHS9 PE=... [more]
CHS8_MEDSA2.107e-10383.52Chalcone synthase 8 OS=Medicago sativa GN=CHS8 PE=... [more]
CHS4_MEDSA2.107e-10383.52Chalcone synthase 4 OS=Medicago sativa GN=CHS4 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H05EF DevOvary1 Citrus clementina cDNA clone C32001H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876220 ID=FC876220|Name=FC876220|organism=Citrus clementina|type=EST|length=716bp
AACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGAA
ATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGC
CACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAGG
CTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACG
GAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGAA
GCGTTACATATACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGT
GCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGGTC
GAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAATG
GGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCCG
GCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCTG
CGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCGG
CGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGCGC
TCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGGCC
CTGCCGATACTCATCTTGATTCTCTTGTGGGCCAGGCTTTGTTCGGTGAT
GGTGCTGCTGCTGTGA
back to top