FC876220

Overview
NameFC876220
Unique NameFC876220
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length716
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:8..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSD_IPONI (Chalcone synthase D OS=Ipomoea nil GN=CHSD PE=2 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 2.107e-103
Identity = 154/183 (84.15%), Postives = 172/183 (93.99%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNRA 599
            M TV+E+R AQRA+GPAT+LAIGTATPA+ V+Q+ YPDYYFRIT S+HMT+LK+KF+RMCDKSMI KRY++LTEEILKENP+ C YMAPSLDARQDIVVVEVPKLGKEAA  AIKEWGQPKSKITH+IFCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKDLAENN+A
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITNSDHMTDLKQKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKA 183          

HSP 2 Score: 73.559 bits (179), Expect = 2.107e-103
Identity = 35/41 (85.37%), Postives = 38/41 (92.68%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            + ARVLVVCSEIT VTFRGP +THLDSLVGQALFGDGAAA+
Sbjct:  182 KAARVLVVCSEITVVTFRGPNETHLDSLVGQALFGDGAAAI 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS3_GERHY (Chalcone synthase 3 OS=Gerbera hybrida GN=CHS3 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 4.677e-103
Identity = 152/179 (84.92%), Postives = 170/179 (94.97%), Query Frame = 3
Query:   60 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            V+ IR AQRA+GPAT+LAIGTATPA+ V QADYPDYYFR+T+SEHM +LKEKF+RMCDKSMI+KRY+++TEE LKENP+MC +MAPSLDARQD+VVVEVPKLGKEAATKAIKEWG PKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:   10 VETIRKAQRAEGPATILAIGTATPANCVYQADYPDYYFRVTESEHMVDLKEKFQRMCDKSMIRKRYMHITEEFLKENPSMCKFMAPSLDARQDLVVVEVPKLGKEAATKAIKEWGFPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 188          

HSP 2 Score: 75.0998 bits (183), Expect = 4.677e-103
Identity = 37/41 (90.24%), Postives = 39/41 (95.12%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP + HLDSLVGQALFGDGAAAV
Sbjct:  188 KGARVLVVCSEITAVTFRGPNEGHLDSLVGQALFGDGAAAV 228          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS3_MEDSA (Chalcone synthase 4-1 OS=Medicago sativa GN=CHS4-1 PE=2 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.678e-103
Identity = 150/182 (82.42%), Postives = 169/182 (92.86%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIR AQRA+GPAT++AIGTA P++ V Q+ YPD+YF+IT SEH  ELKEKF+RMCDKSMIK+RY+YLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVSEIRQAQRAEGPATIMAIGTANPSNCVEQSTYPDFYFKITNSEHKVELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 78.9518 bits (193), Expect = 4.678e-103
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+TAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS1_TRISU (Chalcone synthase 1 OS=Trifolium subterraneum GN=CHS1 PE=3 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.678e-103
Identity = 152/182 (83.52%), Postives = 167/182 (91.76%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIR AQRA+GPAT+LAIGTA P + V QA YPD+YF+IT SEH  ELKEKF+RMCDKSMIK RY+YLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVAEIRKAQRAEGPATILAIGTANPPNRVEQATYPDFYFKITNSEHKVELKEKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 78.9518 bits (193), Expect = 4.678e-103
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+TAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_ARAAL (Chalcone synthase OS=Arabis alpina GN=CHS PE=3 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 6.104e-103
Identity = 152/180 (84.44%), Postives = 167/180 (92.78%), Query Frame = 3
Query:   57 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            +++EIR AQRADGPA +L IGTA P + V QA+YPDYYFRIT S+HMT+LKEKFKRMCDKSMI+KR+++LTEE LKENP MCAYMAPSLD RQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNR
Sbjct:    4 SLEEIRKAQRADGPAGILGIGTANPPNHVLQAEYPDYYFRITNSDHMTDLKEKFKRMCDKSMIRKRHMHLTEEFLKENPKMCAYMAPSLDTRQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNR 183          

HSP 2 Score: 77.0258 bits (188), Expect = 6.104e-103
Identity = 37/41 (90.24%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQALF DGAAA+
Sbjct:  183 RGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAAL 223          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS4_PEA (Chalcone synthase 4 OS=Pisum sativum GN=CHS4 PE=3 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 6.104e-103
Identity = 151/182 (82.97%), Postives = 168/182 (92.31%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YFRIT SEH  ELK+KF+RMCDKSMI +RY+YLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFRITNSEHKIELKQKFQRMCDKSMINRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 78.9518 bits (193), Expect = 6.104e-103
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+TAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS1_PEA (Chalcone synthase 1 OS=Pisum sativum GN=CHS1 PE=2 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 6.104e-103
Identity = 151/182 (82.97%), Postives = 168/182 (92.31%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIR  QRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH T LKEKF+RMCDKSMIK+RY+YLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVSEIRKPQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTVLKEKFQRMCDKSMIKRRYMYLTEEILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 78.9518 bits (193), Expect = 6.104e-103
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+TAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_ARATH (Chalcone synthase OS=Arabidopsis thaliana GN=CHS PE=1 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 7.963e-103
Identity = 152/181 (83.98%), Postives = 168/181 (92.82%), Query Frame = 3
Query:   54 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            +++ EIR AQRADGPA +LAIGTA P + V QA+YPDYYFRIT SEHMT+LKEKFKRMCDKS I+KR+++LTEE LKENP+MCAYMAPSLD RQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKDLAENNR
Sbjct:    7 SSLDEIRQAQRADGPAGILAIGTANPENHVLQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKENPHMCAYMAPSLDTRQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRIAKDLAENNR 187          

HSP 2 Score: 77.0258 bits (188), Expect = 7.963e-103
Identity = 37/41 (90.24%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQALF DGAAA+
Sbjct:  187 RGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAAL 227          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS3_IPOBA (Chalcone synthase LF3 OS=Ipomoea batatas GN=CHS-LF3 PE=2 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 7.964e-103
Identity = 154/182 (84.62%), Postives = 167/182 (91.76%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV E+R AQRA+GPAT+LAIGTATPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRY++LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIK WGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVGEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKGWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 75.0998 bits (183), Expect = 7.964e-103
Identity = 35/41 (85.37%), Postives = 39/41 (95.12%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVL+VCSEIT VTFRGP++ HLDSLVGQALFGDGAAAV
Sbjct:  182 KGARVLIVCSEITVVTFRGPSEAHLDSLVGQALFGDGAAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS2_DAUCA (Chalcone synthase 2 OS=Daucus carota GN=CHS2 PE=2 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 1.039e-102
Identity = 151/180 (83.89%), Postives = 167/180 (92.78%), Query Frame = 3
Query:   54 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            A ++EIR  QRA GPA +LAIGTATP++ V QADYPDYYFRIT SEHM++LK KFKRMC+KSMI+KRY+++TEE LKENPN+CAY APSLDARQD+VVVEVP+LGKEAA KAIKEWG PKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    6 AEIEEIRKRQRAQGPANILAIGTATPSNCVYQADYPDYYFRITNSEHMSDLKLKFKRMCEKSMIRKRYMHITEEYLKENPNVCAYEAPSLDARQDLVVVEVPRLGKEAAAKAIKEWGHPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 185          

HSP 2 Score: 78.5666 bits (192), Expect = 1.039e-102
Identity = 38/40 (95.00%), Postives = 40/40 (100.00%), Query Frame = 2
Query:  596 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            GARVLVVCSEITAVTFRGP+D+HLDSLVGQALFGDGAAAV
Sbjct:  187 GARVLVVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAV 226          
The following BLAST results are available for this feature:
BLAST of FC876220 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSD_IPONI2.107e-10384.15Chalcone synthase D OS=Ipomoea nil GN=CHSD PE=2 SV... [more]
CHS3_GERHY4.677e-10384.92Chalcone synthase 3 OS=Gerbera hybrida GN=CHS3 PE=... [more]
CHS3_MEDSA4.678e-10382.42Chalcone synthase 4-1 OS=Medicago sativa GN=CHS4-1... [more]
CHS1_TRISU4.678e-10383.52Chalcone synthase 1 OS=Trifolium subterraneum GN=C... [more]
CHSY_ARAAL6.104e-10384.44Chalcone synthase OS=Arabis alpina GN=CHS PE=3 SV=... [more]
CHS4_PEA6.104e-10382.97Chalcone synthase 4 OS=Pisum sativum GN=CHS4 PE=3 ... [more]
CHS1_PEA6.104e-10382.97Chalcone synthase 1 OS=Pisum sativum GN=CHS1 PE=2 ... [more]
CHSY_ARATH7.963e-10383.98Chalcone synthase OS=Arabidopsis thaliana GN=CHS P... [more]
CHS3_IPOBA7.964e-10384.62Chalcone synthase LF3 OS=Ipomoea batatas GN=CHS-LF... [more]
CHS2_DAUCA1.039e-10283.89Chalcone synthase 2 OS=Daucus carota GN=CHS2 PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H05EF DevOvary1 Citrus clementina cDNA clone C32001H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876220 ID=FC876220|Name=FC876220|organism=Citrus clementina|type=EST|length=716bp
AACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGAA
ATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGC
CACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAGG
CTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACG
GAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGAA
GCGTTACATATACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGT
GCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGGTC
GAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAATG
GGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCCG
GCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCTG
CGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCGG
CGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGCGC
TCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGGCC
CTGCCGATACTCATCTTGATTCTCTTGTGGGCCAGGCTTTGTTCGGTGAT
GGTGCTGCTGCTGTGA
back to top