FC876220

Overview
NameFC876220
Unique NameFC876220
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length716
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:8..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS1_CASGL (Chalcone synthase OS=Casuarina glauca GN=CHS1 PE=2 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 5.046e-108
Identity = 159/182 (87.36%), Postives = 173/182 (95.05%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV+E+R AQRA+GPATVLAIGTATP + ++Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKRY+YLTEEILKE+PNMCAYMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNR
Sbjct:    1 MVTVEEVRKAQRAEGPATVLAIGTATPPNCLDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMYLTEEILKEHPNMCAYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNR 182          

HSP 2 Score: 80.1073 bits (196), Expect = 5.046e-108
Identity = 38/41 (92.68%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 RGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAI 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_PUELO (Chalcone synthase OS=Pueraria lobata GN=CHS PE=2 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 8.590e-108
Identity = 160/182 (87.91%), Postives = 172/182 (94.51%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIR AQRA+GPAT+LAIGTA P + V+Q+ YPDYYFRIT SEHMTELKEKF+RMCDKSMIKKRY+YLTEEILKENPNMCAYMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTK +GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVAEIRQAQRAEGPATILAIGTANPPNCVDQSTYPDYYFRITNSEHMTELKEKFQRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKQLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 80.4925 bits (197), Expect = 8.590e-108
Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQALFGDGAAAV
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_PHAVU (Chalcone synthase 17 OS=Phaseolus vulgaris GN=CHS17 PE=2 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 1.121e-107
Identity = 159/182 (87.36%), Postives = 173/182 (95.05%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIR AQRA+GPAT+LAIGTATP++ V+Q+ YPDYYFRIT SEHMT+LKEKF+RMCDKSMIKKRY++L EEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVSEIRQAQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMCDKSMIKKRYMHLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 80.4925 bits (197), Expect = 1.121e-107
Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQALFGDGAAAV
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_ANTMA (Chalcone synthase OS=Antirrhinum majus GN=CHS PE=3 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 1.121e-107
Identity = 159/181 (87.85%), Postives = 172/181 (95.03%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            M TV+E+R AQRA+GPATVLAIGTATPA+ V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKS IK+RY++LTEEILKENP MC YMAPSLDARQDIVVVEVP+LGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    1 MVTVEEVRRAQRAEGPATVLAIGTATPANCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSNIKRRYMHLTEEILKENPAMCEYMAPSLDARQDIVVVEVPRLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENN 181          

HSP 2 Score: 81.2629 bits (199), Expect = 1.121e-107
Identity = 40/40 (100.00%), Postives = 40/40 (100.00%), Query Frame = 2
Query:  596 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV
Sbjct:  183 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_VITVI (Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 1.462e-107
Identity = 161/181 (88.95%), Postives = 172/181 (95.03%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            M +V EIR AQRA+GPATVLAIGTATPA+ V QADYPDYYFRIT SEHMTELKEKFKRMC+KSMI KRY++LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GL+PSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVAEIRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 78.9518 bits (193), Expect = 1.462e-107
Identity = 38/40 (95.00%), Postives = 40/40 (100.00%), Query Frame = 2
Query:  596 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            G+RVLVVCSEITAVTFRGP+DTHLDSLVGQALFGDGAAAV
Sbjct:  183 GSRVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS1_CAMSI (Chalcone synthase 1 OS=Camellia sinensis GN=CHS1 PE=2 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 5.529e-107
Identity = 158/182 (86.81%), Postives = 171/182 (93.96%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV++IR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEH  ELKEKFKRMCDKSMIKKRY+YLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVEDIRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKKRYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 80.1073 bits (196), Expect = 5.529e-107
Identity = 38/41 (92.68%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAI 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS6_SOYBN (Chalcone synthase 6 OS=Glycine max GN=CHS6 PE=3 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 5.529e-107
Identity = 158/181 (87.29%), Postives = 172/181 (95.03%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            M +V+EIR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT S+HM ELKEKFKRMCDKSMIKKRY+YL EEILKENP++CAYM PSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSDHMNELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMEPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 80.1073 bits (196), Expect = 5.529e-107
Identity = 39/40 (97.50%), Postives = 40/40 (100.00%), Query Frame = 2
Query:  596 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            GARVLVVCSEITAVTFRGP+DTHLDSLVGQALFGDGAAAV
Sbjct:  183 GARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS4_SORBI (Chalcone synthase 4 OS=Sorghum bicolor GN=CHS4 PE=3 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 9.410e-107
Identity = 160/180 (88.89%), Postives = 171/180 (95.00%), Query Frame = 3
Query:   57 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRY++LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSVKR MMYQQGCFAGGTVLR+AKDLAENNR
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNR 186          

HSP 2 Score: 76.6406 bits (187), Expect = 9.410e-107
Identity = 36/41 (87.80%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+++HLDS+VGQALFGDGAAAV
Sbjct:  186 RGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAV 226          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_VIGUN (Chalcone synthase OS=Vigna unguiculata GN=CHS PE=2 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 9.412e-107
Identity = 157/182 (86.26%), Postives = 173/182 (95.05%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V EIR AQRA+GPAT+LAIGTATP + V+Q+ YPDYYFRIT SEHMT+LKEKF+RMCDKSMIKKRY+++TEEILKENP+MCAYMAPSLDARQDIVVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVSEIRQAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMCDKSMIKKRYMHVTEEILKENPSMCAYMAPSLDARQDIVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 80.4925 bits (197), Expect = 9.412e-107
Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQALFGDGAAAV
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_HYPAN (Chalcone synthase OS=Hypericum androsaemum PE=1 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 1.228e-106
Identity = 157/182 (86.26%), Postives = 169/182 (92.86%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV+E+R AQRA+GPATV+AIGTA P + V+QA YPDYYFRIT SEH  ELKEKF+RMCDKS IKKRY+YL EE+LKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVEEVRKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKKRYMYLNEEVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 79.7221 bits (195), Expect = 1.228e-106
Identity = 38/41 (92.68%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAI 222          
The following BLAST results are available for this feature:
BLAST of FC876220 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS1_CASGL5.046e-10887.36Chalcone synthase OS=Casuarina glauca GN=CHS1 PE=2... [more]
CHSY_PUELO8.590e-10887.91Chalcone synthase OS=Pueraria lobata GN=CHS PE=2 S... [more]
CHSY_PHAVU1.121e-10787.36Chalcone synthase 17 OS=Phaseolus vulgaris GN=CHS1... [more]
CHSY_ANTMA1.121e-10787.85Chalcone synthase OS=Antirrhinum majus GN=CHS PE=3... [more]
CHSY_VITVI1.462e-10788.95Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV... [more]
CHS1_CAMSI5.529e-10786.81Chalcone synthase 1 OS=Camellia sinensis GN=CHS1 P... [more]
CHS6_SOYBN5.529e-10787.29Chalcone synthase 6 OS=Glycine max GN=CHS6 PE=3 SV... [more]
CHS4_SORBI9.410e-10788.89Chalcone synthase 4 OS=Sorghum bicolor GN=CHS4 PE=... [more]
CHSY_VIGUN9.412e-10786.26Chalcone synthase OS=Vigna unguiculata GN=CHS PE=2... [more]
CHSY_HYPAN1.228e-10686.26Chalcone synthase OS=Hypericum androsaemum PE=1 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H05EF DevOvary1 Citrus clementina cDNA clone C32001H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876220 ID=FC876220|Name=FC876220|organism=Citrus clementina|type=EST|length=716bp
AACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGAA
ATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGC
CACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAGG
CTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACG
GAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGAA
GCGTTACATATACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGT
GCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGGTC
GAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAATG
GGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCCG
GCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCTG
CGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCGG
CGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGCGC
TCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGGCC
CTGCCGATACTCATCTTGATTCTCTTGTGGGCCAGGCTTTGTTCGGTGAT
GGTGCTGCTGCTGTGA
back to top