FC876220

Overview
NameFC876220
Unique NameFC876220
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length716
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:8..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: THS2_ARAHY (Putative stilbene synthase 2 (Fragment) OS=Arachis hypogaea PE=5 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 1.932e-59
Identity = 86/106 (81.13%), Postives = 97/106 (91.51%), Query Frame = 3
Query:  279 LKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            LKENPNMCAY APSLDAR+D+++ EVP++GKEAATKAIKEWGQP SKITHLIFCTTSGV +PG DY+L  L+GL PSVKR+MMY QGCFAGGTVLRLAKDLAENN+
Sbjct:    1 LKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGVDYELIVLLGLDPSVKRYMMYHQGCFAGGTVLRLAKDLAENNK 106          

HSP 2 Score: 66.2402 bits (160), Expect = 1.932e-59
Identity = 31/39 (79.49%), Postives = 36/39 (92.31%), Query Frame = 2
Query:  599 ARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            ARVL+VCSE TAVTFRGP++T +DSLVGQALF DGAAA+
Sbjct:  108 ARVLIVCSENTAVTFRGPSETDMDSLVGQALFADGAAAI 146          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS6_MEDSA (Chalcone synthase 6-4 (Fragment) OS=Medicago sativa GN=CHS6-4 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 2.950e-54
Identity = 73/78 (93.59%), Postives = 76/78 (97.44%), Query Frame = 3
Query:  363 LGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 LGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 78          

HSP 2 Score: 78.9518 bits (193), Expect = 2.950e-54
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+TAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:   78 KGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 118          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS7_MEDSA (Chalcone synthase (Fragment) OS=Medicago sativa GN=CHSII PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 1.450e-40
Identity = 53/59 (89.83%), Postives = 56/59 (94.92%), Query Frame = 3
Query:  420 ITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            ITHLI CTTS VDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 ITHLIVCTTS-VDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 58          

HSP 2 Score: 78.9518 bits (193), Expect = 1.450e-40
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSE+TAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:   58 KGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 98          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_MALDO (Chalcone synthase (Fragment) OS=Malus domestica GN=CHS PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.843e-25
Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQALFGDGAAAV
Sbjct:   25 KGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 65          

HSP 2 Score: 53.9138 bits (128), Expect = 9.843e-25
Identity = 24/25 (96.00%), Postives = 25/25 (100.00%), Query Frame = 3
Query:  522 MMYQQGCFAGGTVLRLAKDLAENNR 596
            MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MMYQQGCFAGGTVLRLAKDLAENNK 25          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: PKS1_DICDI (Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.335e-18
Identity = 54/193 (27.98%), Postives = 97/193 (50.26%), Query Frame = 3
Query:    9 KHEPQTYSLRVQLEMATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAE 587
            +H+ Q   ++V ++       R + +++  + VL IG + P   ++Q    D        +   E  EK KR+ ++S IK R++ + +    EN     ++    D       V VP L ++A  +A+K+WG  K  ITH++  T++G+ +P  +++L  L+GL   V+R  +   GC AG + LR A  LA+
Sbjct: 2758 QHQKQQQKVQV-IQQQQQPLSRLSYKSNNNSFVLGIGISVPGEPISQQSLKDSISNDFSDK--AETNEKVKRIFEQSQIKTRHL-VRDYTKPENSIKFRHLETITDVNNQFKKV-VPDLAQQACLRALKDWGGDKGDITHIVSVTSTGIIIPDVNFKLIDLLGLNKDVERVSLNLMGCLAGLSSLRTAASLAK 2945          

HSP 2 Score: 29.6462 bits (65), Expect = 2.335e-18
Identity = 14/37 (37.84%), Postives = 23/37 (62.16%), Query Frame = 2
Query:  602 RVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAA 712
            R+LVVC+E+ ++ F        D +V  ++F DG+AA
Sbjct: 2951 RILVVCTEVCSLHFSNTDGG--DQMVASSIFADGSAA 2985          
The following BLAST results are available for this feature:
BLAST of FC876220 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
THS2_ARAHY1.932e-5981.13Putative stilbene synthase 2 (Fragment) OS=Arachis... [more]
CHS6_MEDSA2.950e-5493.59Chalcone synthase 6-4 (Fragment) OS=Medicago sativ... [more]
CHS7_MEDSA1.450e-4089.83Chalcone synthase (Fragment) OS=Medicago sativa GN... [more]
CHSY_MALDO9.843e-2595.12Chalcone synthase (Fragment) OS=Malus domestica GN... [more]
PKS1_DICDI2.335e-1827.98Probable polyketide synthase 1 OS=Dictyostelium di... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H05EF DevOvary1 Citrus clementina cDNA clone C32001H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876220 ID=FC876220|Name=FC876220|organism=Citrus clementina|type=EST|length=716bp
AACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGAA
ATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGC
CACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAGG
CTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACG
GAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGAA
GCGTTACATATACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGT
GCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGGTC
GAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAATG
GGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCCG
GCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCTG
CGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCGG
CGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGCGC
TCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGGCC
CTGCCGATACTCATCTTGATTCTCTTGTGGGCCAGGCTTTGTTCGGTGAT
GGTGCTGCTGCTGTGA
back to top