FC876220

Overview
NameFC876220
Unique NameFC876220
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length716
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:8..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSB_PEA (Chalcone synthase 1B OS=Pisum sativum GN=CHS-1B PE=3 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 1.228e-106
Identity = 158/182 (86.81%), Postives = 172/182 (94.51%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV EIR AQ+A+GPATVLAIGTATP + V+Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKRY++LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVDEIRQAQKAEGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPHVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 80.4925 bits (197), Expect = 1.228e-106
Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQALFGDGAAAV
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS1_HORVU (Chalcone synthase 1 OS=Hordeum vulgare GN=CHS1 PE=3 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 1.602e-106
Identity = 158/180 (87.78%), Postives = 173/180 (96.11%), Query Frame = 3
Query:   57 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            TV+E+RNAQRA+GPATVLAIGTATPA+ V QADYPDYYF+ITKS+HM +LKEKFKRMCDKS I+KRY++LTEEIL+ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQP+SKITHL+FCTTSGVDMPGADYQLTK++GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNR
Sbjct:    6 TVEEVRNAQRAEGPATVLAIGTATPANCVYQADYPDYYFKITKSDHMADLKEKFKRMCDKSQIRKRYMHLTEEILEENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPRSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNR 185          

HSP 2 Score: 76.2554 bits (186), Expect = 1.602e-106
Identity = 37/41 (90.24%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP ++HLDSLVGQALFGDGAAAV
Sbjct:  185 RGARVLVVCSEITAVTFRGPHESHLDSLVGQALFGDGAAAV 225          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSE_IPONI (Chalcone synthase E OS=Ipomoea nil GN=CHSE PE=2 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 1.602e-106
Identity = 156/182 (85.71%), Postives = 173/182 (95.05%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV+E+R AQRA GPAT++AIGT+TP + V+Q+ YPDYYFRIT SEH+ ELKEKFKRMC+KSMIKKRY+YLTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GL+PSVKRFMMYQQGCFAGGTV+RLAKDLAENN+
Sbjct:    1 MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNK 182          

HSP 2 Score: 77.411 bits (189), Expect = 1.602e-106
Identity = 37/41 (90.24%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+D HLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS6_SORBI (Chalcone synthase 6 OS=Sorghum bicolor GN=CHS6 PE=3 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 3.558e-106
Identity = 159/180 (88.33%), Postives = 170/180 (94.44%), Query Frame = 3
Query:   57 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRY++LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENNR
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNR 186          

HSP 2 Score: 76.6406 bits (187), Expect = 3.558e-106
Identity = 36/41 (87.80%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+++HLDS+VGQALFGDGAAAV
Sbjct:  186 RGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAV 226          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS2_SORBI (Chalcone synthase 2 OS=Sorghum bicolor GN=CHS2 PE=3 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 3.558e-106
Identity = 159/180 (88.33%), Postives = 170/180 (94.44%), Query Frame = 3
Query:   57 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRY++LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENNR
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNR 186          

HSP 2 Score: 76.6406 bits (187), Expect = 3.558e-106
Identity = 36/41 (87.80%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+++HLDS+VGQALFGDGAAAV
Sbjct:  186 RGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAV 226          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS1_SORBI (Chalcone synthase 1 OS=Sorghum bicolor GN=CHS1 PE=3 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 3.558e-106
Identity = 159/180 (88.33%), Postives = 170/180 (94.44%), Query Frame = 3
Query:   57 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRY++LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENNR
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNR 186          

HSP 2 Score: 76.6406 bits (187), Expect = 3.558e-106
Identity = 36/41 (87.80%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+++HLDS+VGQALFGDGAAAV
Sbjct:  186 RGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAV 226          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS1_GERHY (Chalcone synthase 1 OS=Gerbera hybrida GN=CHS1 PE=2 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 3.558e-106
Identity = 156/179 (87.15%), Postives = 171/179 (95.53%), Query Frame = 3
Query:   60 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            ++ IR+AQRA+GPAT+LAIGTATPA+ V QADYPDYYFRITKSEHM +LKEKFKRMCDKSMI+KRY+++TEE LK+NPNMCAYMAPSLD RQD+VVVEVPKLGKEAA KAIKEWG PKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    7 MKAIRDAQRAEGPATILAIGTATPANCVYQADYPDYYFRITKSEHMVDLKEKFKRMCDKSMIRKRYMHITEEYLKQNPNMCAYMAPSLDVRQDLVVVEVPKLGKEAAMKAIKEWGHPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNK 185          

HSP 2 Score: 79.337 bits (194), Expect = 3.558e-106
Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP DTHLDSLVGQALFGDGAAAV
Sbjct:  185 KGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAV 225          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSB_SOLTU (Chalcone synthase 1B OS=Solanum tuberosum GN=CHS1B PE=2 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 3.559e-106
Identity = 158/182 (86.81%), Postives = 171/182 (93.96%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV+E R AQRA+GPAT+LAIGT+TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMCDKSMIKKRY++LTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPG DYQL KL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 77.0258 bits (188), Expect = 3.559e-106
Identity = 36/41 (87.80%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+++HLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAI 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS5_SORBI (Chalcone synthase 5 OS=Sorghum bicolor GN=CHS5 PE=3 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 4.642e-106
Identity = 159/180 (88.33%), Postives = 170/180 (94.44%), Query Frame = 3
Query:   57 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRY++LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENNR
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAHKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNR 186          

HSP 2 Score: 76.6406 bits (187), Expect = 4.642e-106
Identity = 36/41 (87.80%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+++HLDS+VGQALFGDGAAAV
Sbjct:  186 RGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAV 226          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSJ_PETHY (Chalcone synthase J OS=Petunia hybrida GN=CHSJ PE=2 SV=2)

HSP 1 Score: 327.405 bits (838), Expect = 4.643e-106
Identity = 157/182 (86.26%), Postives = 172/182 (94.51%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV+EIR AQRA+GPAT++AIGTATP++ V+Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKRY++LTEEILKENPN+C YMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLR SVKR MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVEEIRRAQRAEGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 78.9518 bits (193), Expect = 4.643e-106
Identity = 38/41 (92.68%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP DTHLDSLVGQALFGDGAAA+
Sbjct:  182 KGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAI 222          
The following BLAST results are available for this feature:
BLAST of FC876220 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSB_PEA1.228e-10686.81Chalcone synthase 1B OS=Pisum sativum GN=CHS-1B PE... [more]
CHS1_HORVU1.602e-10687.78Chalcone synthase 1 OS=Hordeum vulgare GN=CHS1 PE=... [more]
CHSE_IPONI1.602e-10685.71Chalcone synthase E OS=Ipomoea nil GN=CHSE PE=2 SV... [more]
CHS6_SORBI3.558e-10688.33Chalcone synthase 6 OS=Sorghum bicolor GN=CHS6 PE=... [more]
CHS2_SORBI3.558e-10688.33Chalcone synthase 2 OS=Sorghum bicolor GN=CHS2 PE=... [more]
CHS1_SORBI3.558e-10688.33Chalcone synthase 1 OS=Sorghum bicolor GN=CHS1 PE=... [more]
CHS1_GERHY3.558e-10687.15Chalcone synthase 1 OS=Gerbera hybrida GN=CHS1 PE=... [more]
CHSB_SOLTU3.559e-10686.81Chalcone synthase 1B OS=Solanum tuberosum GN=CHS1B... [more]
CHS5_SORBI4.642e-10688.33Chalcone synthase 5 OS=Sorghum bicolor GN=CHS5 PE=... [more]
CHSJ_PETHY4.643e-10686.26Chalcone synthase J OS=Petunia hybrida GN=CHSJ PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H05EF DevOvary1 Citrus clementina cDNA clone C32001H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876220 ID=FC876220|Name=FC876220|organism=Citrus clementina|type=EST|length=716bp
AACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGAA
ATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGC
CACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAGG
CTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACG
GAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGAA
GCGTTACATATACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGT
GCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGGTC
GAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAATG
GGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCCG
GCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCTG
CGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCGG
CGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGCGC
TCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGGCC
CTGCCGATACTCATCTTGATTCTCTTGTGGGCCAGGCTTTGTTCGGTGAT
GGTGCTGCTGCTGTGA
back to top