FC876221

Overview
NameFC876221
Unique NameFC876221
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:7..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSD_PETHY (Chalcone synthase D OS=Petunia hybrida GN=CHSD PE=3 SV=2)

HSP 1 Score: 369.777 bits (948), Expect = 8.253e-102
Identity = 182/222 (81.98%), Postives = 200/222 (90.09%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV+E+RNAQRA+GPATVLAIGTATP++ V+Q+ YPDYYFRIT SEH TELKEKFKR+CDKSMIKKRYM+LTE+ILKENPN+C  MAPSL AR +I  VEVPKLGKEAA KAI+EW QPKS+ITHL+FCTT+GV MPGAD+QLTKL+GL  SVKRFMM Q GCFAGGTVLRLAKDLAENNKGARVLVVCSEIT VTFRGP DTH DSLVG ALFGDGAAAV
Sbjct:    1 MVTVEEVRNAQRAEGPATVLAIGTATPSNCVDQSTYPDYYFRITDSEHKTELKEKFKRICDKSMIKKRYMHLTEKILKENPNICESMAPSLDARTNIYAVEVPKLGKEAAEKAIEEWNQPKSRITHLVFCTTTGVSMPGADFQLTKLLGLGSSVKRFMMNQLGCFAGGTVLRLAKDLAENNKGARVLVVCSEITVVTFRGPNDTHFDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS1_DAUCA (Chalcone synthase 1 OS=Daucus carota GN=CHS1 PE=2 SV=1)

HSP 1 Score: 367.466 bits (942), Expect = 4.096e-101
Identity = 181/222 (81.53%), Postives = 197/222 (88.74%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV E R AQRA+GPATVLAIGTATP + V+Q+ Y DYYFRIT SE   ELKEKF+RMC+KSMI  RYM+LTE++LK+NP+ C YMA SL ARQDIVV EVPKLGKEAA +AIKEWGQPKSKITHLIFCTTSGVDMPGAD++LTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNK ARVLVVCSEIT +TFRGP DTHLDSLVG ALFGDGA AV
Sbjct:    1 MVTVNEFRKAQRAEGPATVLAIGTATPPNCVDQSAYADYYFRITNSEDKPELKEKFRRMCEKSMINTRYMHLTEDLLKQNPSFCEYMASSLDARQDIVVNEVPKLGKEAALRAIKEWGQPKSKITHLIFCTTSGVDMPGADFRLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKNARVLVVCSEITVITFRGPNDTHLDSLVGQALFGDGAGAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS9_DAUCA (Chalcone synthase 9 OS=Daucus carota GN=CHS9 PE=2 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.192e-100
Identity = 180/222 (81.08%), Postives = 197/222 (88.74%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV E R AQRA+GPATVLAIGTATP + V+Q+ Y DYYFRIT SE   ELKEKF+RMC+KSMI  RYM+LTE++LK+NP+ C YMA SL ARQDIVV EVPKLGKEAA +AIKEWG+PKSKITHLIFCTTSGVDMPGAD++LTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNK ARVLVVCSEIT +TFRGP DTHLDSLVG ALFGDGA AV
Sbjct:    1 MVTVNEFRKAQRAEGPATVLAIGTATPPNCVDQSAYADYYFRITNSEDKPELKEKFRRMCEKSMINTRYMHLTEDLLKQNPSFCEYMASSLDARQDIVVNEVPKLGKEAALRAIKEWGRPKSKITHLIFCTTSGVDMPGADFRLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKNARVLVVCSEITVITFRGPNDTHLDSLVGQALFGDGAGAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: THS2_VITVI (Stilbene synthase 2 OS=Vitis vinifera GN=GSVIVT00004047001 PE=2 SV=2)

HSP 1 Score: 358.221 bits (918), Expect = 2.485e-98
Identity = 172/222 (77.48%), Postives = 198/222 (89.19%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            MA+V+EIRNAQRA GPAT+LAIGTATP H V Q+DY DYYFR+TKSEHMT LK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL  RQ+I+  EVPKLGKEAA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL PSV+R M+Y QGC+AGGTVLR AKDLAENN GARVLVVCSEIT VTFRGP++  LDSLVG ALFGDG+AAV
Sbjct:    1 MASVEEIRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTALKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLEPSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: THS5_VITVI (Stilbene synthase 5 OS=Vitis vinifera GN=GSVIVT00007357001 PE=3 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 9.443e-98
Identity = 171/222 (77.03%), Postives = 198/222 (89.19%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            MA+V+EIRNAQRA GPAT+LAIGTATP H V Q+DY DYYF++TKSEHMTELK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL  RQ+I+  EVPKLGKEAA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL  SV+R M+Y QGC+AGGTVLR AKDLAENN GARVLVVCSEIT VTFRGP++  LDSLVG ALFGDG+AAV
Sbjct:    1 MASVEEIRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFKVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: THS4_VITVI (Stilbene synthase 4 OS=Vitis vinifera GN=GSVIVT00005194001 PE=3 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 1.611e-97
Identity = 171/222 (77.03%), Postives = 199/222 (89.64%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            MA+V+EIRNAQRA GPATVLAIGTATP + + Q+D+ DYYFR+TKSEHMTELK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL  RQ+I+  EVPKLGKEAA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL PSV+R M+Y QGC+AGGTVLR AKDLAENN GARVLVVCSEIT VTFRGP++  LDSLVG ALFGDG+AAV
Sbjct:    1 MASVEEIRNAQRAKGPATVLAIGTATPDNCLYQSDFADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLEPSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: VPS_HUMLU (Phloroisovalerophenone synthase OS=Humulus lupulus GN=VPS PE=2 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 6.121e-97
Identity = 166/220 (75.45%), Postives = 196/220 (89.09%), Query Frame = 1
Query:   58 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            TV++IR AQRA+GPAT+LAIGTA PA+  NQAD+PDYYFR+TKSEHMT+LK+KF+RMC+KS IKKRY++LTEE LK+NP++C Y APSL  RQD++VVEVPKLGKEAA  AIKEWGQPKSKITHLIFCT S +DMPGADYQ  KL+GLRPSVKR M+YQ GC+AGG VLR+AKD+AENNKGARVL+VCSEITA  FRGP++ HLD LVG +LFGDGA++V
Sbjct:    5 TVEQIRKAQRAEGPATILAIGTAVPANCFNQADFPDYYFRVTKSEHMTDLKKKFQRMCEKSTIKKRYLHLTEEHLKQNPHLCEYNAPSLNTRQDMLVVEVPKLGKEAAINAIKEWGQPKSKITHLIFCTGSSIDMPGADYQCAKLLGLRPSVKRVMLYQLGCYAGGKVLRIAKDIAENNKGARVLIVCSEITACIFRGPSEKHLDCLVGQSLFGDGASSV 224          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_EQUAR (Chalcone synthase OS=Equisetum arvense GN=CHS PE=2 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 7.994e-97
Identity = 175/223 (78.48%), Postives = 191/223 (85.65%), Query Frame = 1
Query:   49 EMATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            E A     R AQRA+GPATVLAIGTA PA+   Q+ YPD+YF IT S+HMTELK KF RMC KS IKKRYM+L  EILK NP++CAY   SL  RQDI VVEVPKLGKEA+ KAIKEWGQPKSKITHL+FCTTSGVDMPGAD+ LTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKD+AENNKGARVLVVCSEIT VTFRGP++THLDSLVG ALFGDGAAAV
Sbjct:    6 ESADASSRRLAQRANGPATVLAIGTANPANVFEQSSYPDFYFDITNSQHMTELKLKFSRMCQKSGIKKRYMHLNSEILKANPSLCAYWEKSLDVRQDIAVVEVPKLGKEASLKAIKEWGQPKSKITHLVFCTTSGVDMPGADWALTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDVAENNKGARVLVVCSEITCVTFRGPSETHLDSLVGQALFGDGAAAV 228          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSF_PETHY (Chalcone synthase F OS=Petunia hybrida GN=CHSF PE=2 SV=2)

HSP 1 Score: 352.443 bits (903), Expect = 1.364e-96
Identity = 170/222 (76.58%), Postives = 194/222 (87.39%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V+E+R AQR +GPAT+LAIGTATP + V+Q  YPDY+FR+T S+H TELKEKFKRM ++SMIKK Y++LTEEILKENP++C + APS  ARQDIVVVEVPKLGKEAA  AIKEWGQPKSKITHL+FCTT+GVDM GADYQLTKL+GL PSVKR MMYQ GC+ GGTVLRLAKDLAENNKGAR LVVCSEITA+TF  P+DT LD LVG ALFGDGAA+V
Sbjct:    1 MVSVEEVRRAQRREGPATILAIGTATPLNCVDQTTYPDYFFRVTNSDHKTELKEKFKRMFERSMIKKSYLHLTEEILKENPSICEHKAPSFDARQDIVVVEVPKLGKEAAQNAIKEWGQPKSKITHLVFCTTTGVDMHGADYQLTKLLGLSPSVKRLMMYQLGCYGGGTVLRLAKDLAENNKGARALVVCSEITAITFHAPSDTDLDVLVGQALFGDGAASV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: THS7_VITVI (Stilbene synthase 6 OS=Vitis vinifera GN=STS PE=2 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 3.038e-96
Identity = 167/222 (75.23%), Postives = 197/222 (88.74%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            MA+V+E RNAQRA GPAT+LAIGTATP H V Q+DY DYYFR+TKSEHMTELK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL  RQ+I+  EVP+LG++AA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL  SV+R M+Y QGC+AGGTVLR AKDLAENN GARVLVVCSEIT VTFRGP++  LDSLVG ALFGDG++AV
Sbjct:    1 MASVEEFRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPRLGRDAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSSAV 222          
The following BLAST results are available for this feature:
BLAST of FC876221 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 146
Match NameE-valueIdentityDescription
CHSD_PETHY8.253e-10281.98Chalcone synthase D OS=Petunia hybrida GN=CHSD PE=... [more]
CHS1_DAUCA4.096e-10181.53Chalcone synthase 1 OS=Daucus carota GN=CHS1 PE=2 ... [more]
CHS9_DAUCA1.192e-10081.08Chalcone synthase 9 OS=Daucus carota GN=CHS9 PE=2 ... [more]
THS2_VITVI2.485e-9877.48Stilbene synthase 2 OS=Vitis vinifera GN=GSVIVT000... [more]
THS5_VITVI9.443e-9877.03Stilbene synthase 5 OS=Vitis vinifera GN=GSVIVT000... [more]
THS4_VITVI1.611e-9777.03Stilbene synthase 4 OS=Vitis vinifera GN=GSVIVT000... [more]
VPS_HUMLU6.121e-9775.45Phloroisovalerophenone synthase OS=Humulus lupulus... [more]
CHSY_EQUAR7.994e-9778.48Chalcone synthase OS=Equisetum arvense GN=CHS PE=2... [more]
CHSF_PETHY1.364e-9676.58Chalcone synthase F OS=Petunia hybrida GN=CHSF PE=... [more]
THS7_VITVI3.038e-9675.23Stilbene synthase 6 OS=Vitis vinifera GN=STS PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H09EF DevOvary1 Citrus clementina cDNA clone C32001H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876221 ID=FC876221|Name=FC876221|organism=Citrus clementina|type=EST|length=718bp
GAACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGA
AATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGG
CCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAG
GCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGAC
GGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGA
AGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATG
TGCGCTTACATGGCTCCATCACTCGGCGCACGCCAAGACATTGTGGTGGT
CGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAAT
GGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCC
GGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCT
GCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCG
GCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGCTTTGTTCGGTG
ATGGTGCTGCTGCTGTGA
back to top