FC876221

Overview
NameFC876221
Unique NameFC876221
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:7..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: THS2_ARAHY (Putative stilbene synthase 2 (Fragment) OS=Arachis hypogaea PE=5 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.596e-63
Identity = 116/146 (79.45%), Postives = 131/146 (89.73%), Query Frame = 1
Query:  280 LKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            LKENPNMCAY APSL AR+D+++ EVP++GKEAATKAIKEWGQP SKITHLIFCTTSGV +PG DY+L  L+GL PSVKR+MMY QGCFAGGTVLRLAKDLAENNK ARVL+VCSE TAVTFRGP++T +DSLVG ALF DGAAA+
Sbjct:    1 LKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGVDYELIVLLGLDPSVKRYMMYHQGCFAGGTVLRLAKDLAENNKDARVLIVCSENTAVTFRGPSETDMDSLVGQALFADGAAAI 146          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS6_MEDSA (Chalcone synthase 6-4 (Fragment) OS=Medicago sativa GN=CHS6-4 PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 6.616e-59
Identity = 110/118 (93.22%), Postives = 115/118 (97.46%), Query Frame = 1
Query:  364 LGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 LGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 118          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS7_MEDSA (Chalcone synthase (Fragment) OS=Medicago sativa GN=CHSII PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 4.163e-45
Identity = 90/99 (90.91%), Postives = 95/99 (95.96%), Query Frame = 1
Query:  421 ITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            ITHLI CTTS VDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 ITHLIVCTTS-VDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 98          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_MALDO (Chalcone synthase (Fragment) OS=Malus domestica GN=CHS PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 4.182e-29
Identity = 63/65 (96.92%), Postives = 64/65 (98.46%), Query Frame = 1
Query:  523 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVG ALFGDGAAAV
Sbjct:    1 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 65          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: PKS1_DICDI (Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.882e-21
Identity = 67/235 (28.51%), Postives = 120/235 (51.06%), Query Frame = 1
Query:   10 KHEPQTYSLRVQLEMATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAA 714
            +H+ Q   ++V ++       R + +++  + VL IG + P   ++Q    D        +   E  EK KR+ ++S IK R++ + +    EN     ++            V VP L ++A  +A+K+WG  K  ITH++  T++G+ +P  +++L  L+GL   V+R  +   GC AG + LR A  LA+ +   R+LVVC+E+ ++ F        D +V  ++F DG+AA
Sbjct: 2758 QHQKQQQKVQV-IQQQQQPLSRLSYKSNNNSFVLGIGISVPGEPISQQSLKDSISNDFSDK--AETNEKVKRIFEQSQIKTRHL-VRDYTKPENSIKFRHLETITDVNNQFKKV-VPDLAQQACLRALKDWGGDKGDITHIVSVTSTGIIIPDVNFKLIDLLGLNKDVERVSLNLMGCLAGLSSLRTAASLAKASPRNRILVVCTEVCSLHFSNTDGG--DQMVASSIFADGSAA 2985          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: BCSA_BACSU (Putative chalcone synthase OS=Bacillus subtilis GN=bcsA PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.352e-11
Identity = 60/213 (28.17%), Postives = 100/213 (46.95%), Query Frame = 1
Query:  100 ATVLAIGTATPAHSVNQ---ADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIK--EWGQ---PKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAA 714
            A +L+IGT+ PA++VNQ   A++  Y F+ +  + +  L   FK       I  R      E  KE          S   +  I + E  K  + A  + +   E+ Q   P  K+  + F +++G+  P  + +L   +   P  KR  ++  GC  G + L  A +  +    A VLV+ +E+ ++TF+ P D    +L+G +LFGDG AA
Sbjct:    2 AFILSIGTSLPAYNVNQEKAAEFARYMFQHSFKD-IDRLLSSFKN----GQIHSRQFVKPIEWYKEGH--------SFEEKNQIYIEETLKHSRAAVRECLSHPEFFQEAIPYEKVEAVFFVSSTGLSTPSIEARLMNELPFSPYTKRIPIWGLGCAGGASGLARAAEYCKAYPEAFVLVISAELCSLTFQ-PEDKTKSNLIGTSLFGDGIAA 200          
The following BLAST results are available for this feature:
BLAST of FC876221 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 146
Match NameE-valueIdentityDescription
THS2_ARAHY2.596e-6379.45Putative stilbene synthase 2 (Fragment) OS=Arachis... [more]
CHS6_MEDSA6.616e-5993.22Chalcone synthase 6-4 (Fragment) OS=Medicago sativ... [more]
CHS7_MEDSA4.163e-4590.91Chalcone synthase (Fragment) OS=Medicago sativa GN... [more]
CHSY_MALDO4.182e-2996.92Chalcone synthase (Fragment) OS=Malus domestica GN... [more]
PKS1_DICDI1.882e-2128.51Probable polyketide synthase 1 OS=Dictyostelium di... [more]
BCSA_BACSU1.352e-1128.17Putative chalcone synthase OS=Bacillus subtilis GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H09EF DevOvary1 Citrus clementina cDNA clone C32001H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876221 ID=FC876221|Name=FC876221|organism=Citrus clementina|type=EST|length=718bp
GAACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGA
AATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGG
CCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAG
GCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGAC
GGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGA
AGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATG
TGCGCTTACATGGCTCCATCACTCGGCGCACGCCAAGACATTGTGGTGGT
CGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAAT
GGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCC
GGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCT
GCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCG
GCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGCTTTGTTCGGTG
ATGGTGCTGCTGCTGTGA
back to top