FC876221

Overview
NameFC876221
Unique NameFC876221
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:7..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSA_PEA (Chalcone synthase 1A OS=Pisum sativum GN=CHS-1A PE=3 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 3.696e-110
Identity = 195/222 (87.84%), Postives = 208/222 (93.69%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV EIR AQRA+GPATV AIGTATP + V Q+ YPD+YFRIT S+H TELKEKF+RMCDKSMIKKRYM+LTEEILKENP++C YMAPSL ARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVG ALFGDGAAAV
Sbjct:    1 MVTVNEIRQAQRAEGPATVFAIGTATPQNCVEQSTYPDFYFRITNSQHKTELKEKFQRMCDKSMIKKRYMHLTEEILKENPSLCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS7_SOYBN (Chalcone synthase 7 OS=Glycine max GN=CHS7 PE=3 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 3.696e-110
Identity = 195/222 (87.84%), Postives = 207/222 (93.24%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V EIR AQRA+GPAT+LAIGTA P + V+Q+ YPDYYFRIT S+HMTELKEKF+RMCDKSMIK RYMYL EEILKENPNMCAYMAPSL ARQD+VVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTK +GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVG ALFGDGAAAV
Sbjct:    1 MVSVAEIRQAQRAEGPATILAIGTANPPNRVDQSTYPDYYFRITNSDHMTELKEKFQRMCDKSMIKTRYMYLNEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKQLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS6_SORBI (Chalcone synthase 6 OS=Sorghum bicolor GN=CHS6 PE=3 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 4.827e-110
Identity = 193/220 (87.73%), Postives = 208/220 (94.55%), Query Frame = 1
Query:   58 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSL ARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDS+VG ALFGDGAAAV
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAV 226          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS2_SORBI (Chalcone synthase 2 OS=Sorghum bicolor GN=CHS2 PE=3 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 4.827e-110
Identity = 193/220 (87.73%), Postives = 208/220 (94.55%), Query Frame = 1
Query:   58 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSL ARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDS+VG ALFGDGAAAV
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAV 226          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS2_SOLLC (Chalcone synthase 2 OS=Solanum lycopersicum GN=CHS2 PE=2 SV=2)

HSP 1 Score: 397.127 bits (1019), Expect = 4.827e-110
Identity = 192/222 (86.49%), Postives = 209/222 (94.14%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV+E+R AQRA GPAT++AIGTATP++ V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMI KRYM+LTEEILKENPN+C YMAPSL ARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTV+RLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDS+VG ALFGD AAA+
Sbjct:    1 MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMINKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDRAAAM 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS1_SORBI (Chalcone synthase 1 OS=Sorghum bicolor GN=CHS1 PE=3 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 4.827e-110
Identity = 193/220 (87.73%), Postives = 208/220 (94.55%), Query Frame = 1
Query:   58 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSL ARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDS+VG ALFGDGAAAV
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAV 226          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS5_SORBI (Chalcone synthase 5 OS=Sorghum bicolor GN=CHS5 PE=3 SV=1)

HSP 1 Score: 396.741 bits (1018), Expect = 6.305e-110
Identity = 193/220 (87.73%), Postives = 208/220 (94.55%), Query Frame = 1
Query:   58 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSL ARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDS+VG ALFGDGAAAV
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAHKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAV 226          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS7_SORBI (Chalcone synthase 7 OS=Sorghum bicolor GN=CHS7 PE=3 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 1.075e-109
Identity = 192/220 (87.27%), Postives = 208/220 (94.55%), Query Frame = 1
Query:   58 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMT+LKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSL ARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDS+VG ALFGDGAAAV
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTDLKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAV 226          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS3_SORBI (Chalcone synthase 3 OS=Sorghum bicolor GN=CHS3 PE=3 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 1.075e-109
Identity = 192/220 (87.27%), Postives = 208/220 (94.55%), Query Frame = 1
Query:   58 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMT+LKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSL ARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDS+VG ALFGDGAAAV
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTDLKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAV 226          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS1_CITSI (Chalcone synthase 1 OS=Citrus sinensis GN=CHS1 PE=2 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 1.075e-109
Identity = 193/222 (86.94%), Postives = 209/222 (94.14%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV E+R AQRA GPAT++AIGTATP + V+Q+ YPDYYFRIT SEHMT+LKEKFKRMCDKSMIKKRYMYLTEEILKENPN+CAYMAPSL  RQD+VVVEVP+LGK AAT+AIKEWGQPKSKITHL+FCTTSGVDMPGADY+LTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVTVDEVRKAQRAQGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCDKSMIKKRYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGK-AATEAIKEWGQPKSKITHLVFCTTSGVDMPGADYRLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAI 221          
The following BLAST results are available for this feature:
BLAST of FC876221 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 146
Match NameE-valueIdentityDescription
CHSA_PEA3.696e-11087.84Chalcone synthase 1A OS=Pisum sativum GN=CHS-1A PE... [more]
CHS7_SOYBN3.696e-11087.84Chalcone synthase 7 OS=Glycine max GN=CHS7 PE=3 SV... [more]
CHS6_SORBI4.827e-11087.73Chalcone synthase 6 OS=Sorghum bicolor GN=CHS6 PE=... [more]
CHS2_SORBI4.827e-11087.73Chalcone synthase 2 OS=Sorghum bicolor GN=CHS2 PE=... [more]
CHS2_SOLLC4.827e-11086.49Chalcone synthase 2 OS=Solanum lycopersicum GN=CHS... [more]
CHS1_SORBI4.827e-11087.73Chalcone synthase 1 OS=Sorghum bicolor GN=CHS1 PE=... [more]
CHS5_SORBI6.305e-11087.73Chalcone synthase 5 OS=Sorghum bicolor GN=CHS5 PE=... [more]
CHS7_SORBI1.075e-10987.27Chalcone synthase 7 OS=Sorghum bicolor GN=CHS7 PE=... [more]
CHS3_SORBI1.075e-10987.27Chalcone synthase 3 OS=Sorghum bicolor GN=CHS3 PE=... [more]
CHS1_CITSI1.075e-10986.94Chalcone synthase 1 OS=Citrus sinensis GN=CHS1 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H09EF DevOvary1 Citrus clementina cDNA clone C32001H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876221 ID=FC876221|Name=FC876221|organism=Citrus clementina|type=EST|length=718bp
GAACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGA
AATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGG
CCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAG
GCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGAC
GGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGA
AGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATG
TGCGCTTACATGGCTCCATCACTCGGCGCACGCCAAGACATTGTGGTGGT
CGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAAT
GGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCC
GGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCT
GCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCG
GCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGCTTTGTTCGGTG
ATGGTGCTGCTGCTGTGA
back to top