FC876221

Overview
NameFC876221
Unique NameFC876221
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:7..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS8_IPOBA (Chalcone synthase DIV OS=Ipomoea batatas GN=CHS-DIV PE=2 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.189e-108
Identity = 189/222 (85.14%), Postives = 205/222 (92.34%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV+E+R AQRA+GPAT+LAIGT TPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSL ARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSG+DMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++THLDSLVG ALFGDGAAAV
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGIDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS6_PEA (Chalcone synthase 6 OS=Pisum sativum GN=CHS6 PE=2 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.189e-108
Identity = 190/222 (85.59%), Postives = 208/222 (93.69%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V EIR AQRA+GPAT+LAIGTATPA+ V Q+ YPD+YF+IT SEH T LKEKF+RMCDKSMIK+RYMYLTEEILKENP++C YMAPSL ARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTATPANCVEQSTYPDFYFKITNSEHKTVLKEKFQRMCDKSMIKRRYMYLTEEILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS1_IPOBA (Chalcone synthase LF1 OS=Ipomoea batatas GN=CHS-LF1 PE=2 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.189e-108
Identity = 189/222 (85.14%), Postives = 205/222 (92.34%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV+E+R AQRA+GPAT+LAIGT TPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSL ARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSG+DMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++THLDSLVG ALFGDGAAAV
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGIDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_RAPSA (Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.553e-108
Identity = 191/221 (86.43%), Postives = 207/221 (93.67%), Query Frame = 1
Query:   55 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            +++ EIR AQRADGPA +LAIGTA PA+ V QA+YPDYYFRIT SEHMT+LKEKFKRMCDKS I+KR+M+LTEE LKENPNMCAYMAPSL ARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVG ALF DGAAA+
Sbjct:    6 SSLDEIRKAQRADGPAGILAIGTANPANHVLQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAAL 226          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_CATRO (Chalcone synthase OS=Catharanthus roseus GN=CHS PE=2 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.553e-108
Identity = 192/222 (86.49%), Postives = 209/222 (94.14%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M  V+EIRNAQRA GPATVLAIGT+TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMC+KSMIKKRYM+LTEEIL+ENPN+CAYMAPSL ARQ+IVVVEVPKLGKEAA KAIKEWGQ KSKITHL+FCTTSGVDMPGADYQLTKL+GLR SVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+++HLDSLVG ALFGDGAAA+
Sbjct:    1 MVNVEEIRNAQRAQGPATVLAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKRYMHLTEEILQENPNICAYMAPSLDARQNIVVVEVPKLGKEAAQKAIKEWGQSKSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAI 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS3_TRISU (Chalcone synthase 3 OS=Trifolium subterraneum GN=CHS3 PE=2 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.553e-108
Identity = 190/222 (85.59%), Postives = 206/222 (92.79%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V EIR AQRA+GPAT+LAIGTA PA+ V QA YPD+YF+IT SEH  ELKEKF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSL ARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVSVSEIRQAQRAEGPATILAIGTANPANKVEQATYPDFYFKITNSEHKVELKEKFQRMCDKSMIKSRYMYLTEEILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS2_MEDSA (Chalcone synthase 2 OS=Medicago sativa GN=CHS2 PE=1 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.553e-108
Identity = 190/222 (85.59%), Postives = 207/222 (93.24%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH TELKEKF+RMCDKSMIK+RYMYLTEEILKENPN+C YMAPSL ARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS2_MAIZE (Chalcone synthase C2 OS=Zea mays GN=C2 PE=3 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.553e-108
Identity = 190/220 (86.36%), Postives = 207/220 (94.09%), Query Frame = 1
Query:   58 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            TV+E+R AQRA GPATVLAIGTATPA+ V QADYPDYYFRITKSEH+T+LKEKFKRMCDKSMI+KRYM+LTEE L ENP+MCAYMAPSL ARQD+VVVEVPKLGK AA KAIKEWGQPKS+ITHL+FCTTSGVDMPGADYQLTK +GLRPSV R MMYQQGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDSLVG ALFGDGAAAV
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVYQADYPDYYFRITKSEHLTDLKEKFKRMCDKSMIRKRYMHLTEEFLAENPSMCAYMAPSLDARQDVVVVEVPKLGKAAAQKAIKEWGQPKSRITHLVFCTTSGVDMPGADYQLTKALGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAV 226          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS7_IPOBA (Chalcone synthase DIII OS=Ipomoea batatas GN=CHS-DIII PE=2 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 2.028e-108
Identity = 190/222 (85.59%), Postives = 205/222 (92.34%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV+E+R A+RA+GPAT+LAIGTATPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSL ARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH+ FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++THLDSLVG ALFGDGAAAV
Sbjct:    1 MVTVEEVRKAKRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVFFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS4_TRISU (Chalcone synthase 4 (Fragment) OS=Trifolium subterraneum GN=CHS4 PE=2 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 2.028e-108
Identity = 190/222 (85.59%), Postives = 206/222 (92.79%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V EIR AQRA+GPAT+LAIGTA PA+ V QA YPD+YF+IT SEH  ELKEKF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSL ARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANKVEQATYPDFYFKITNSEHKVELKEKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
The following BLAST results are available for this feature:
BLAST of FC876221 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 146
Match NameE-valueIdentityDescription
CHS8_IPOBA1.189e-10885.14Chalcone synthase DIV OS=Ipomoea batatas GN=CHS-DI... [more]
CHS6_PEA1.189e-10885.59Chalcone synthase 6 OS=Pisum sativum GN=CHS6 PE=2 ... [more]
CHS1_IPOBA1.189e-10885.14Chalcone synthase LF1 OS=Ipomoea batatas GN=CHS-LF... [more]
CHSY_RAPSA1.553e-10886.43Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 ... [more]
CHSY_CATRO1.553e-10886.49Chalcone synthase OS=Catharanthus roseus GN=CHS PE... [more]
CHS3_TRISU1.553e-10885.59Chalcone synthase 3 OS=Trifolium subterraneum GN=C... [more]
CHS2_MEDSA1.553e-10885.59Chalcone synthase 2 OS=Medicago sativa GN=CHS2 PE=... [more]
CHS2_MAIZE1.553e-10886.36Chalcone synthase C2 OS=Zea mays GN=C2 PE=3 SV=1[more]
CHS7_IPOBA2.028e-10885.59Chalcone synthase DIII OS=Ipomoea batatas GN=CHS-D... [more]
CHS4_TRISU2.028e-10885.59Chalcone synthase 4 (Fragment) OS=Trifolium subter... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H09EF DevOvary1 Citrus clementina cDNA clone C32001H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876221 ID=FC876221|Name=FC876221|organism=Citrus clementina|type=EST|length=718bp
GAACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGA
AATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGG
CCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAG
GCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGAC
GGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGA
AGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATG
TGCGCTTACATGGCTCCATCACTCGGCGCACGCCAAGACATTGTGGTGGT
CGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAAT
GGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCC
GGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCT
GCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCG
GCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGCTTTGTTCGGTG
ATGGTGCTGCTGCTGTGA
back to top