FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P1_CANGA (Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Candida glabrata GN=GPD1 PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 3.162e-30
Identity = 61/143 (42.66%), Postives = 89/143 (62.24%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            V++ INGFGRIGR+V R+ ++RD +++VA+NDPFIT DY  YM KYDS HG++        DDK L+   K +  +  R+P ++PW +   + V+E+TGVFT               V+I+ PS  APMFV GVN+ +Y  ++
Sbjct:    2 VRVAINGFGRIGRIVLRIAMKRDGIDVVAINDPFITNDYAAYMFKYDSTHGRYDGE--VTHDDKDLIIDGKAIKCYQERDPADLPWGDNDIDIVIEATGVFTAKDLAEKHITAGAKKVVITGPSATAPMFVKGVNDDKYTSDV 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P2_YEAST (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Saccharomyces cerevisiae GN=TDH2 PE=1 SV=3)

HSP 1 Score: 130.568 bits (327), Expect = 4.130e-30
Identity = 65/143 (45.45%), Postives = 87/143 (60.84%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            V++ INGFGRIGRLV R+ LQR +VE+VA+NDPFI+ DY  YM KYDS HG++        DDK ++     +  F  R+P  +PWA    +  ++STGVF                V+I+APS  APMFV+GVNE +Y  +L
Sbjct:    2 VRVAINGFGRIGRLVMRIALQRKNVEVVALNDPFISNDYSAYMFKYDSTHGRYAGE--VSHDDKHIIVDGHKIATFQERDPANLPWASLNIDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPMFVMGVNEEKYTSDL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P1_AGABI (Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Agaricus bisporus GN=gpd1 PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 4.130e-30
Identity = 67/142 (47.18%), Postives = 89/142 (62.68%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            V +GINGFGRIGRLV R  LQ   + +VAVNDPF+  +YM Y+ KYDSVHG+++  +++ KD K ++ G K +  F  R P  I WA+ GAEY+VESTGVF                V+I+AP    P +VVGVN  +Y P+
Sbjct:    2 VNVGINGFGRIGRLVLRNALQMQILTVVAVNDPFLDVEYMAYLFKYDSVHGRYQ-GKVETKDGKLIIDGHK-IAAFAEREPANIKWADCGAEYIVESTGVFKTEELAKEHLKGGAKKVVITAPGSGVPTYVVGVNLDKYDPK 141          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PT_BOVIN (Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Bos taurus GN=GAPDHS PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 5.394e-30
Identity = 67/139 (48.20%), Postives = 88/139 (63.31%), Query Frame = 3
Query:   87 IGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKP 503
            +GINGFGRIGRLV R  +++  V++VAVNDPFI  +YM YM KYDS HG++K +    K    L+     ++VF  + P+EIPW   G+ +VVE+TGV+                V+I APS DAPMFV+GVNE EY P
Sbjct:   65 VGINGFGRIGRLVLRACMEKG-VKVVAVNDPFIDLEYMVYMFKYDSTHGRYKGNVEHKKGQ--LVVDNNEISVFQCKQPKEIPWKSVGSPFVVEATGVYLSLEETKAHIEAGAQRVVICAPSPDAPMFVMGVNEKEYNP 200          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P2_KLUMA (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Kluyveromyces marxianus GN=GAP2 PE=3 SV=2)

HSP 1 Score: 129.798 bits (325), Expect = 7.045e-30
Identity = 66/139 (47.48%), Postives = 85/139 (61.15%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            V+I INGFGRIGRLV R+ L R ++E+VA+NDPFIT DY  YM KYDS HG++        D K+L+   K V VF  R+P  +PW     +  ++STG+F                V+I+APS  APMFVVGVNE +Y
Sbjct:    2 VRIAINGFGRIGRLVLRIALSRKNIEVVAINDPFITVDYAAYMFKYDSTHGRFDGE--VSHDGKSLIIDGKKVLVFQERDPATLPWGAEKIDIAIDSTGIFKELDSAQKHIDAGAKKVVITAPSSTAPMFVVGVNEDKY 138          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P3_KLUMA (Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Kluyveromyces marxianus GN=GAP3 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 9.201e-30
Identity = 66/139 (47.48%), Postives = 84/139 (60.43%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            V+I INGFGRIGRLV R+ L R ++E+VA+NDPFIT DY  YM KYDS HG++        D K L+   K V VF  R+P  +PW     +  ++STG+F                V+I+APS  APMFVVGVNE +Y
Sbjct:    2 VRIAINGFGRIGRLVLRIALSRKNIEVVAINDPFITVDYAAYMFKYDSTHGRFDGE--VSHDGKALIIDGKKVLVFQERDPATLPWGAEKIDIAIDSTGIFKELDSAQKHIDAGAKKVVITAPSSTAPMFVVGVNEDKY 138          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_PHYIN (Glyceraldehyde-3-phosphate dehydrogenase OS=Phytophthora infestans GN=GPDA PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.202e-29
Identity = 66/144 (45.83%), Postives = 88/144 (61.11%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLF-GEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            + + INGFGRIGRLV R   +   + +VA+NDPF++T YM YM +YD+VHG++   +  +  D+T +F   KP+ VF   NPE I W E   +YVVESTG FT               V+ISAPS DAPMFV+GVN   Y+  +
Sbjct:    1 MNVAINGFGRIGRLVLRASAKNPLINIVAINDPFVSTTYMEYMLEYDTVHGKF---DGSLSHDETHIFVNGKPIRVFNEMNPENIKWGEEQVQYVVESTGAFTTLEKASTHLKNGVEKVVISAPSSDAPMFVMGVNHELYEKNM 141          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PT_MACFA (Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Macaca fascicularis GN=GAPDHS PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.050e-29
Identity = 65/142 (45.77%), Postives = 94/142 (66.20%), Query Frame = 3
Query:   78 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKP 503
            ++ +GINGFGRIGRLV R  +++  V++VAVNDPFI  +YM YM KYDS HG++K   ++ ++ + L+     ++V+  + P++IPW + G+ YVVESTGV+                V+ISAPS DAP FV+GVNE+ Y P
Sbjct:   76 ELTVGINGFGRIGRLVLRACMEKG-VKVVAVNDPFIDPEYMVYMFKYDSTHGRYK-GSVEFRNGQ-LVVDNHEISVYQCKEPKQIPWRDVGSPYVVESTGVYLSIEAASNHISAGAQRVVISAPSPDAPTFVMGVNENNYNP 214          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PT_RAT (Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Rattus norvegicus GN=Gapdhs PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 2.677e-29
Identity = 67/142 (47.18%), Postives = 92/142 (64.79%), Query Frame = 3
Query:   78 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKP 503
            ++ +GINGFGRIGRLV RV +++  V +VAVNDPFI  +YM YM KYDS HG++K   ++ K+ + L+     + VF  + P+EIPW+  G  YVVE+TGV+                VI++APS DAPM V+GVNE +Y P
Sbjct:   99 ELTVGINGFGRIGRLVLRVCMEKG-VRVVAVNDPFIDPEYMVYMFKYDSTHGRYK-GTVEHKNGR-LVVDNLEINVFQCKEPKEIPWSSVGNPYVVEATGVYLSIEAASGHISSGARRVIVTAPSPDAPMLVMGVNEKDYNP 237          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PT_MOUSE (Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Mus musculus GN=Gapdhs PE=1 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 7.789e-29
Identity = 64/142 (45.07%), Postives = 93/142 (65.49%), Query Frame = 3
Query:   78 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKP 503
            ++ +GINGFGRIGRLV RV +++  + +VAVNDPFI  +YM YM KYDS HG++K + ++ K+ + L+     +  +  ++P+EIPW+  G  YVVE TGV+                V+++APS DAPMFV+GVNE +Y P
Sbjct:  107 ELTVGINGFGRIGRLVLRVCMEKG-IRVVAVNDPFIDPEYMVYMFKYDSTHGRYKGN-VEHKNGQ-LVVDNLEINTYQCKDPKEIPWSSIGNPYVVECTGVYLSIEAASAHISSGARRVVVTAPSPDAPMFVMGVNEKDYNP 245          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3P1_CANGA3.162e-3042.66Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Cand... [more]
G3P2_YEAST4.130e-3045.45Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Sacc... [more]
G3P1_AGABI4.130e-3047.18Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Agar... [more]
G3PT_BOVIN5.394e-3048.20Glyceraldehyde-3-phosphate dehydrogenase, testis-s... [more]
G3P2_KLUMA7.045e-3047.48Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Kluy... [more]
G3P3_KLUMA9.201e-3047.48Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Kluy... [more]
G3P_PHYIN1.202e-2945.83Glyceraldehyde-3-phosphate dehydrogenase OS=Phytop... [more]
G3PT_MACFA2.050e-2945.77Glyceraldehyde-3-phosphate dehydrogenase, testis-s... [more]
G3PT_RAT2.677e-2947.18Glyceraldehyde-3-phosphate dehydrogenase, testis-s... [more]
G3PT_MOUSE7.789e-2945.07Glyceraldehyde-3-phosphate dehydrogenase, testis-s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top