FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_ECHMU (Glyceraldehyde-3-phosphate dehydrogenase OS=Echinococcus multilocularis PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.329e-28
Identity = 67/144 (46.53%), Postives = 88/144 (61.11%), Query Frame = 3
Query:   78 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            K ++GINGFGRIGRLV R  +  + V +VAVNDPFI  +YM YM KYDS HG++K  ++KV D   L+     +TVF   +   +PW++ GAEY+VESTG+ T               VIISAPS D+    VGVN  +Y P +
Sbjct:    2 KPQVGINGFGRIGRLVLRAAVASNSVNVVAVNDPFIDLEYMVYMFKYDSAHGRYK-GDVKV-DGGKLVIDSHRITVFQEMSASAVPWSQAGAEYIVESTGINTTVEKASAHFQGGAKKVIISAPSADSSHVRVGVNHEKYDPSM 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_DICDI (Glyceraldehyde-3-phosphate dehydrogenase OS=Dictyostelium discoideum GN=gpdA PE=1 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 5.049e-28
Identity = 62/140 (44.29%), Postives = 84/140 (60.00%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYK 500
            V IGINGFGRIGRLV R  L+  +  ++A+N+PF+   YM YM KYDS HG++K     +  +   +     + VF  ++P  I W+  GAEY+VESTG+F                V+ISAPS DAPM+V+GVNE  Y+
Sbjct:    3 VPIGINGFGRIGRLVLRASLENPECRVLAINEPFMDVKYMVYMFKYDSTHGRFKGTVEDINGE--FVVNGNKIHVFAEKDPANIKWSSVGAEYIVESTGLFLSTEKAGVHLKGGAKKVVISAPSTDAPMYVMGVNEETYE 140          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_MESAU (Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Mesocricetus auratus GN=GAPDH PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 6.594e-28
Identity = 66/134 (49.25%), Postives = 84/134 (62.69%), Query Frame = 3
Query:  108 RIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            RIGRLV R       V++VA+NDPFI  +YM YM +YDS HG++K   +K ++ K ++ G K +T+F  R+P  I W + GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    1 RIGRLVTRAAFTSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFKG-TVKAENGKLVING-KAITIFQERDPTNIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHDKYDNSL 132          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_SHEEP (Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Ovis aries GN=GAPDH PE=2 SV=4)

HSP 1 Score: 122.479 bits (306), Expect = 1.125e-27
Identity = 65/133 (48.87%), Postives = 82/133 (61.65%), Query Frame = 3
Query:  111 IGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            IGRLV R       V++VA+NDPFI   YM YM +YDS HG++ H  +K ++ K ++ G K +T+F  R+P  I W + GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    1 IGRLVTRAAFNTGKVDIVAINDPFIDLHYMVYMFQYDSTHGKF-HGTVKAENGKLVING-KAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKKVIISAPSADAPMFVMGVNHEKYNNTL 131          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P1_GIALA (Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Giardia lamblia GN=GAP1 PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.125e-27
Identity = 65/141 (46.10%), Postives = 84/141 (59.57%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKP 503
            +++GINGFGRIGR+  R  L  D V++VA+NDPF   +YM YM KYD+VHG++    +   +D   + G K ++VF    PEEIPW +T  + V+E TG FT               VIISAPS DAPMFV G N   Y P
Sbjct:    3 IRLGINGFGRIGRMALRASLNIDGVQVVAINDPFTDCEYMEYMLKYDTVHGRF-DGTIAHSEDSITVNGNK-ISVFKSMKPEEIPWGKTQVDIVLECTGRFTTKKDAELHITGGCKRVIISAPSADAPMFVCGCNLETYDP 141          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_BOLED (Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Boletus edulis GN=GPD PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.469e-27
Identity = 64/123 (52.03%), Postives = 78/123 (63.41%), Query Frame = 3
Query:  138 LQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            L+  ++ + AVNDPFI  DYM YM KYDSVHG+++  E+  KD K ++ G K +TVF  R+P  IPW   GA+YVVESTGVFT               VIISAPS DAPMFV GVN   Y P+
Sbjct:    1 LENPEINITAVNDPFIDLDYMVYMFKYDSVHGRFEG-EVSTKDGKLVING-KAITVFAERDPANIPWGTVGAQYVVESTGVFTTIEKASAHLKGGAKKVIISAPSSDAPMFVCGVNLDAYDPK 121          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_AMAMU (Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Amanita muscaria GN=GPD PE=3 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 4.274e-27
Identity = 61/119 (51.26%), Postives = 78/119 (65.55%), Query Frame = 3
Query:  150 DVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            D+++VA+NDPFI   YM YM KYDSVHG++    ++ KD K L   +KP+TVF  R+P +IPW   GAEY+VESTGVFT               ++ISAPS DAPMFV GVN  +Y P+
Sbjct:    4 DLDVVAINDPFIDLAYMVYMFKYDSVHGRFSG-SVETKDGK-LWINQKPITVFRKRDPVQIPWGSAGAEYIVESTGVFTTTEKASAHLKGGAKKIVISAPSADAPMFVCGVNLDKYDPK 120          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_RALSO (Glyceraldehyde-3-phosphate dehydrogenase OS=Ralstonia solanacearum GN=gapA PE=3 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 7.290e-27
Identity = 70/144 (48.61%), Postives = 89/144 (61.81%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVAR-VILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSK-DAPMFVVGVNEHEYKPE 506
            +KIGINGFGRIGR+V R  I    D+E+VA+ND  +  DY+ YM KYDSVHG++   E+ V D  TL+   K + +  V++P E+ W E GA+ VVESTG+F                VI+SAPSK D PMFV GVN   YK E
Sbjct:    3 IKIGINGFGRIGRMVFRAAIANFKDIEVVAIND-LLEPDYLAYMLKYDSVHGRF-DGEVSV-DGNTLVVNGKKIRLTAVKDPAELKWGEVGADVVVESTGIFLTKEGAQKHIDAGAKKVIMSAPSKDDTPMFVYGVNHGTYKGE 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P3_RHIRA (Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Rhizomucor racemosus GN=GPD3 PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 9.522e-27
Identity = 66/146 (45.21%), Postives = 86/146 (58.90%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            M  +  GINGF           L+   V++VA+NDPFI  +YM YM KYDS HG++K   ++ KD K ++ G + + V   R+P +IPW   GA+YV+ESTGVFT               VIISAPS DAPMFVVGVN  +Y  +L
Sbjct:    1 MSTINTGINGFRSHWPYCLACSLENPKVKVVAINDPFIDLEYMVYMFKYDSTHGRFKG-TVEHKDGKLVVNGHE-IAVHAERDPAQIPWGSHGADYVIESTGVFTTKDAASAHLKGGAKKVIISAPSADAPMFVVGVNLDKYTSDL 144          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P2_DROSU (Glyceraldehyde-3-phosphate dehydrogenase 2 (Fragment) OS=Drosophila subobscura GN=Gapdh2 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 2.121e-26
Identity = 65/134 (48.51%), Postives = 81/134 (60.45%), Query Frame = 3
Query:  108 RIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            RIGRLV R  + +    +VAVNDPFI  +YM Y+ K+DS HG++K     V +   L+   + +TVF  R+P  I WA  GAEYVVESTGVFT               V+ISAPS DAPMFV GVN   YKP++
Sbjct:    1 RIGRLVLRAAIDKG-ASVVAVNDPFIDVNYMVYLFKFDSTHGRFKG--TVVAEGGFLVVNGQKITVFSERDPANINWASAGAEYVVESTGVFTTIEKASTHLKGGAKKVVISAPSADAPMFVCGVNLDAYKPDM 131          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3P_ECHMU1.329e-2846.53Glyceraldehyde-3-phosphate dehydrogenase OS=Echino... [more]
G3P_DICDI5.049e-2844.29Glyceraldehyde-3-phosphate dehydrogenase OS=Dictyo... [more]
G3P_MESAU6.594e-2849.25Glyceraldehyde-3-phosphate dehydrogenase (Fragment... [more]
G3P_SHEEP1.125e-2748.87Glyceraldehyde-3-phosphate dehydrogenase (Fragment... [more]
G3P1_GIALA1.125e-2746.10Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Giar... [more]
G3P_BOLED1.469e-2752.03Glyceraldehyde-3-phosphate dehydrogenase (Fragment... [more]
G3P_AMAMU4.274e-2751.26Glyceraldehyde-3-phosphate dehydrogenase (Fragment... [more]
G3P_RALSO7.290e-2748.61Glyceraldehyde-3-phosphate dehydrogenase OS=Ralsto... [more]
G3P3_RHIRA9.522e-2745.21Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Rhiz... [more]
G3P2_DROSU2.121e-2648.51Glyceraldehyde-3-phosphate dehydrogenase 2 (Fragme... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top