FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_LEIME (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Leishmania mexicana GN=GAPC PE=3 SV=3)

HSP 1 Score: 105.916 bits (263), Expect = 1.089e-22
Identity = 59/141 (41.84%), Postives = 78/141 (55.32%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSK-DAPMFVVGVNEHEYK 500
            VK+GINGFGRIGR+V R    R D+E+V +ND  +  +YM Y  KYDS HG++      +K    L+   K + V   R+P  + W E G E VVESTG+F                V+++ P K D PMFV+GVN   YK
Sbjct:    2 VKVGINGFGRIGRVVFRAAQMRPDIEIVGIND-LLDAEYMAYSLKYDSTHGRFDGTVEVIKG--ALVVNGKSIRVTSERDPANLKWDEIGVEVVVESTGLFLTQETAHKHIEAGARRVVMTGPPKDDTPMFVMGVNHTTYK 139          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PG_LEIME (Glyceraldehyde-3-phosphate dehydrogenase, glycosomal OS=Leishmania mexicana GN=GAPG PE=1 SV=3)

HSP 1 Score: 105.531 bits (262), Expect = 1.423e-22
Identity = 60/156 (38.46%), Postives = 86/156 (55.13%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRD----DVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKD-------DKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAP-SKDAPMFVVGVNEHEYKP 503
            M  +K+GINGFGRIGR+V + I  +     ++++VAV D     +Y  Y  K+D+VHG+ K+    VK        D  ++ G +   V   RNP ++PW + G +YV+ESTG+FT               V+ISAP S  A   V+GVN+HEY P
Sbjct:    1 MAPIKVGINGFGRIGRMVFQAICDQGLIGTEIDVVAVVDMSTNAEYFAYQMKHDTVHGRPKYTVEAVKSSPSVETADVLVVNGHRIKCVKAQRNPADLPWGKLGVDYVIESTGLFTDKLKAEGHIKGGAKKVVISAPASGGAKTIVMGVNQHEYSP 156          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_BUCBP (Glyceraldehyde-3-phosphate dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae GN=gapA PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 3.170e-22
Identity = 55/140 (39.29%), Postives = 86/140 (61.43%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKD-APMFVVGVNEHEY 497
            +KIGINGFGRIGR++ R+   R ++E++A+ND  I   Y+ YM KYDS+HG + + ++ +K++ TL    K + +   ++P+ + W +   + V+ESTG+F                VII++P KD  PMFV GVN +EY
Sbjct:    3 IKIGINGFGRIGRVLFRLAQLRSNIEILAIND-LINVQYIAYMLKYDSIHGNF-NGKIVIKNE-TLFVNGKKIRITNEKDPKNLMWGDLNIDVVIESTGIFLTTEDSYKHIQAGAKKVIITSPPKDNTPMFVRGVNFNEY 139          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_CHLPN (Glyceraldehyde-3-phosphate dehydrogenase OS=Chlamydia pneumoniae GN=gap PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 4.140e-22
Identity = 58/144 (40.28%), Postives = 88/144 (61.11%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRD-DVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSK-DAPMFVVGVNEHEYKPE 506
            +K+ INGFGRIGRLV R IL+R+  VE++A+ND  +  D +TY+ K+DS HG++   +++ + D  L+ G++ +     RN + +PW + G + V+E TG+FT               V+ISAP K D P FV+GVN   + PE
Sbjct:    1 MKVVINGFGRIGRLVLRQILKRNSSVEVLAIND-LVPGDALTYLFKFDSTHGRFP-EDVRCEADH-LIVGKRKIQFLSERNVQNLPWKDLGVDLVIECTGLFTKKEDAEKHIQAGAKRVLISAPGKGDIPTFVMGVNHKTFNPE 141          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_BACFR (Glyceraldehyde-3-phosphate dehydrogenase OS=Bacteroides fragilis GN=gap PE=3 SV=2)

HSP 1 Score: 103.99 bits (258), Expect = 4.140e-22
Identity = 59/142 (41.55%), Postives = 86/142 (60.56%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQR--DDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDA-PMFVVGVNEHEY 497
            +K+GINGFGRIGR+V R  ++   +D+++V +ND  +  +Y+ YM KYDSVHG+++  E+ V+D   ++ G K + +    +P  + W E  A+ VVESTG F                VI+SAPSKD+ PMFV GVN   Y
Sbjct:    2 IKVGINGFGRIGRMVFRAAVKNFGNDIQIVGIND-LLDAEYLAYMLKYDSVHGRFE-GEVAVEDGALIVNGNK-IRLTAEMDPANLKWNEVDADVVVESTGFFLTDETARKHIQAGAKKVIMSAPSKDSTPMFVYGVNHTSY 140          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_BACME (Glyceraldehyde-3-phosphate dehydrogenase OS=Bacillus megaterium GN=gap PE=3 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 9.222e-22
Identity = 61/140 (43.57%), Postives = 80/140 (57.14%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPM-FVVGVNEHEY 497
            VKIGINGFGRIGR V R  L+ D+VE+VA+ND     + + ++ KYDSVHG  K     V D   L+   K + +   R+P ++ W + G E VVESTG FT               VIISAP+ D  +  V+GVNE +Y
Sbjct:    3 VKIGINGFGRIGRNVFRAALKNDNVEVVAIND-LTDANMLAHLLKYDSVHG--KLDAEVVVDGSNLVVNGKTIEISAERDPAQLSWGKQGVEIVVESTGFFTKRADAAKHLEAGAKKVIISAPASDEDITIVMGVNEDKY 139          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PG_CRIFA (Glyceraldehyde-3-phosphate dehydrogenase, glycosomal OS=Crithidia fasciculata GN=GAPDG PE=3 SV=3)

HSP 1 Score: 102.449 bits (254), Expect = 1.204e-21
Identity = 58/156 (37.18%), Postives = 87/156 (55.77%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRD----DVELVAVNDPFITTDYMTYMCKYDSVHGQWKH-------HELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAP-SKDAPMFVVGVNEHEYKP 503
            M  +K+GINGFGRIGR+V + + + +    ++++VAV D     +Y  Y  K+D+VHG+ K+            K D  ++ G + + V   RNP ++PW + G +YV+ESTG+FT               V+ISAP S  A   V+GVN+HEY P
Sbjct:    1 MAPIKVGINGFGRIGRMVFQSMCEDNVLGTELDVVAVVDMSTDAEYFAYQMKFDTVHGRPKYTVEVAKSSPSAKKPDVLVVNGHRILCVKADRNPADLPWGKLGVDYVIESTGLFTDKAKAEGHVKGGAKKVVISAPASGGAKTIVMGVNQHEYNP 156          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_BACST (Glyceraldehyde-3-phosphate dehydrogenase OS=Bacillus stearothermophilus GN=gap PE=1 SV=5)

HSP 1 Score: 102.064 bits (253), Expect = 1.573e-21
Identity = 61/143 (42.66%), Postives = 85/143 (59.44%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPM-FVVGVNEHEYKPE 506
            VK+GINGFGRIGR V R  L+  D+E+VAVND     + + ++ KYDSVHG+    E+ V  +  ++ G K + V   R+PE + W E G + VVESTG FT               VIISAP+K+  +  V+GVN+ +Y P+
Sbjct:    3 VKVGINGFGRIGRNVFRAALKNPDIEVVAVND-LTDANTLAHLLKYDSVHGR-LDAEVSVNGNNLVVNG-KEIIVKAERDPENLAWGEIGVDIVVESTGRFTKREDAAKHLEAGAKKVIISAPAKNEDITIVMGVNQDKYDPK 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_BACCO (Glyceraldehyde-3-phosphate dehydrogenase OS=Bacillus coagulans GN=gap PE=1 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 2.055e-21
Identity = 62/140 (44.29%), Postives = 81/140 (57.86%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVV-GVNEHEY 497
            VK+GINGFGRIGR V R  ++  D+E+VAVND     D + ++ KYDSVHG+    E+ V D  ++    K + V   RNPE + W E G + VVESTG FT               VIISAP+K   + VV GVN+ +Y
Sbjct:    3 VKVGINGFGRIGRNVFRAAVKNPDIEVVAVNDLTANADGLAHLLKYDSVHGR-LDAEVVVNDGVSV--NGKEIIVKAERNPENLAWGEIGVDIVVESTGRFTKREDAAKHLEAGAKKVIISAPAKVENITVVMGVNQDKY 139          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_KLEPN (Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Klebsiella pneumoniae GN=gap PE=3 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 2.683e-21
Identity = 56/136 (41.18%), Postives = 79/136 (58.09%), Query Frame = 3
Query:   93 INGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKD-APMFVVGVNEHEY 497
            INGFGRIGR+V R   +R D+E+VA+ND  +  +YM YM KYDS HG++    ++VKD   ++ G+K + V   R+P  + W E G + V E+TG+F                V+++ PSKD  PMFV G N   Y
Sbjct:    1 INGFGRIGRIVFRAAQKRSDIEIVAIND-LLDAEYMAYMLKYDSTHGRF-DGTVEVKDGHLVVNGKK-IRVTAERDPANLKWDEVGVDVVAEATGIFLTDETARKHITAGAKKVVLTGPSKDNTPMFVRGANFDAY 133          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3PC_LEIME1.089e-2241.84Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PG_LEIME1.423e-2238.46Glyceraldehyde-3-phosphate dehydrogenase, glycosom... [more]
G3P_BUCBP3.170e-2239.29Glyceraldehyde-3-phosphate dehydrogenase OS=Buchne... [more]
G3P_CHLPN4.140e-2240.28Glyceraldehyde-3-phosphate dehydrogenase OS=Chlamy... [more]
G3P_BACFR4.140e-2241.55Glyceraldehyde-3-phosphate dehydrogenase OS=Bacter... [more]
G3P_BACME9.222e-2243.57Glyceraldehyde-3-phosphate dehydrogenase OS=Bacill... [more]
G3PG_CRIFA1.204e-2137.18Glyceraldehyde-3-phosphate dehydrogenase, glycosom... [more]
G3P_BACST1.573e-2142.66Glyceraldehyde-3-phosphate dehydrogenase OS=Bacill... [more]
G3P_BACCO2.055e-2144.29Glyceraldehyde-3-phosphate dehydrogenase OS=Bacill... [more]
G3P_KLEPN2.683e-2141.18Glyceraldehyde-3-phosphate dehydrogenase (Fragment... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top