FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PB_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPB PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.923e-19
Identity = 58/150 (38.67%), Postives = 87/150 (58.00%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDD--VELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSK--DAPMFVVGVNEHEYKPEL 509
            + K+K+ INGFGRIGR   R    R D  +++V VND     +  +++ KYDS+ G +K  ++K+ D++T+    K + V   R+P ++PWAE G + V+E TGVF                VII+AP+K  D P +VVGVNE +Y  E+
Sbjct:   52 VAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKN-ASHLLKYDSMLGTFKA-DVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEV 199          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_CORGL (Glyceraldehyde-3-phosphate dehydrogenase OS=Corynebacterium glutamicum GN=gap PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 4.284e-19
Identity = 60/146 (41.10%), Postives = 83/146 (56.85%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQR-DDVELVAVNDPFITTDYMTY--MCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAP-SKDAPMFVVGVNEHEYKPE 506
            +++GINGFGRIGR   R +L+R DD+E+VAVND    TD  T   + K+DS+ G+    E++  DD ++  G K + V+  R+P+ + WA    + V+ESTG FT               VIISAP S +   FV GVN   Y PE
Sbjct:    3 IRVGINGFGRIGRNFFRAVLERSDDLEVVAVND---LTDNKTLSTLLKFDSIMGRLGQ-EVEYDDD-SITVGGKRIAVYAERDPKNLDWAAHNVDIVIESTGFFTDANAAKAHIEAGAKKVIISAPASNEDATFVYGVNHESYDPE 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PB_ARATH (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Arabidopsis thaliana GN=GAPB PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 9.544e-19
Identity = 57/146 (39.04%), Postives = 85/146 (58.22%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDD--VELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSK--DAPMFVVGVNEHEY 497
            + K+K+ INGFGRIGR   R    R D  +E+V +ND     +  +++ KYDS+ G +K  E+K+ D++T+    K + V   R+P ++PWAE G + V+E TGVF                VII+AP+K  D P +V+GVNE +Y
Sbjct:   79 VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKN-ASHLLKYDSMLGTFKA-EVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGASKVIITAPAKGADIPTYVMGVNEQDY 222          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P2_ANASP (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Anabaena sp. (strain PCC 7120) GN=gap2 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 9.544e-19
Identity = 57/148 (38.51%), Postives = 84/148 (56.76%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDD--VELVAVNDPFITTDYMT--YMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAP-MFVVGVNEHEYKPEL 509
            +++ INGFGRIGR  AR  L R++  +ELVAVND   T+D  T  ++ KYDS+ G+ K+ ++   DD ++    K +     RNPE +PW E   + ++E+TGVF                V+I+AP K+    FV+GVN H+Y   L
Sbjct:    2 IRVAINGFGRIGRNFARCWLGRENTNIELVAVND---TSDPRTNAHLLKYDSMLGKLKNVDITA-DDNSITVNGKTIKCVSDRNPENLPWKEWEIDLIIEATGVFVSKEGATKHINAGAKKVLITAPGKNEDGTFVMGVNHHDYDHNL 145          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_XANFL (Glyceraldehyde-3-phosphate dehydrogenase OS=Xanthobacter flavus GN=gap PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.628e-18
Identity = 58/145 (40.00%), Postives = 83/145 (57.24%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQ--RDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVV-GVNEHEYKPE 506
            VK+ INGFGRIGR V R I++  R D+E+VA+ND     +   ++ ++DSVHG++   E+KV  D T+  G  P+ V  VRNP E+P  E G +  +E TG+FT               V++SAP+  A + VV GVN  +   E
Sbjct:    3 VKVAINGFGRIGRNVLRAIIESGRTDIEVVAIND-LGPVETNAHLFRFDSVHGRFPG-EVKVAGD-TIDVGRGPIKVTAVRNPAELPHKELGVDIALECTGIFTSRDKAAAHLAAGAKRVLVSAPADGADLTVVYGVNHEKLTNE 144          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P2_BACSU (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Bacillus subtilis GN=gapB PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.628e-18
Identity = 49/144 (34.03%), Postives = 84/144 (58.33%), Query Frame = 3
Query:   78 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPM-FVVGVNEHEYKPE 506
            KVK+ INGFGRIGR+V R  +  D +++VA+N  + + + + ++ KYD++HG++    +  +D  +L+   K V +   R+P+++PW E   + VVE+TG F                VI++AP K+  +  V+GVNE ++  E
Sbjct:    2 KVKVAINGFGRIGRMVFRKAMLDDQIQVVAINASY-SAETLAHLIKYDTIHGRYDKEVVAGED--SLIVNGKKVLLLNSRDPKQLPWREYDIDIVVEATGKFNAKDKAMGHIEAGAKKVILTAPGKNEDVTIVMGVNEDQFDAE 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_MYCGE (Glyceraldehyde-3-phosphate dehydrogenase OS=Mycoplasma genitalium GN=gapA PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.126e-18
Identity = 53/135 (39.26%), Postives = 77/135 (57.04%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVN 485
            +K+ INGFGRIGRLV R +L + +VE+VA+ND     + + ++ KYDS HG+ K  ++ VK +  L    K V VF  ++P+ +PW E   + V+ESTG F                VIISAP+K+  +  V  N
Sbjct:    8 IKVAINGFGRIGRLVFRSLLSKANVEVVAIND-LTQPEVLAHLLKYDSAHGELK-RKITVKQN-ILQIDRKKVYVFSEKDPQNLPWDEHDIDVVIESTGRFVSEEGASLHLKAGAKRVIISAPAKEKTIRTVVYN 139          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_THEAQ (Glyceraldehyde-3-phosphate dehydrogenase OS=Thermus aquaticus GN=gap PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 2.777e-18
Identity = 58/144 (40.28%), Postives = 80/144 (55.56%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMT--YMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPM-FVVGVNEHEYKP 503
            +K+GINGFGRIGR V R++  R  VE+  +ND    TD  T  ++ KYDS++ ++        DD+ L    K +    V++P+EIPWAE G   V+ESTGVFT               VII+AP+K   +  V+GVN   Y P
Sbjct:    1 MKVGINGFGRIGRQVFRILHSRG-VEVALIND---LTDNKTLAHLLKYDSIYHRFPGEV--AYDDQYLYVDGKAIRATAVKDPKEIPWAEAGVGVVIESTGVFTDADKAKAHLEGGAKKVIITAPAKGEDITIVMGVNHEAYDP 138          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_MYCLE (Glyceraldehyde-3-phosphate dehydrogenase OS=Mycobacterium leprae GN=gapA PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 8.079e-18
Identity = 52/146 (35.62%), Postives = 83/146 (56.85%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRD-----DVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRN-PEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVV-GVNEHEY 497
            V++GINGFGRIGR   R +L +      DV++VA+ND       + Y+ K+DS+ G+  H ++ ++++ T++ G + +    VR  P  +PW   G + VVESTG+FT               VI+SAP+ D  + +V GVN+ +Y
Sbjct:    3 VRVGINGFGRIGRNFYRALLAQQEHGIADVQVVAIND-ITDNSTLAYLLKFDSILGRLPH-DVSLEEEDTIVVGSEKIKALAVREGPAALPWHAFGVDVVVESTGLFTNAAKAKGHLEAGAKKVIVSAPATDPDITIVFGVNDDKY 146          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_STRAE (Glyceraldehyde-3-phosphate dehydrogenase OS=Streptomyces arenae GN=gap PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.070e-17
Identity = 54/144 (37.50%), Postives = 78/144 (54.17%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRD-DVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVV-GVNEHEYKPE 506
            V+IGINGFGRIGR V R    R  ++E+VAVND       M ++  YDS+ G++   E    +   +  G++ + V   R+P  +PW + G + V+ESTG+FT               VII+AP+      VV GVN+ +Y PE
Sbjct:    3 VRIGINGFGRIGRNVFRAAAARSSELEIVAVND-LGDVPTMAHLLAYDSILGRFP--EEVTAEPGAIRVGDRTIKVLAERDPGALPWGDLGVDIVIESTGIFTDAAKARSHVDGGAKKVIIAAPASGEDFTVVLGVNDGDYDPE 143          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3PB_TOBAC1.923e-1938.67Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3P_CORGL4.284e-1941.10Glyceraldehyde-3-phosphate dehydrogenase OS=Coryne... [more]
G3PB_ARATH9.544e-1939.04Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3P2_ANASP9.544e-1938.51Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Anab... [more]
G3P_XANFL1.628e-1840.00Glyceraldehyde-3-phosphate dehydrogenase OS=Xantho... [more]
G3P2_BACSU1.628e-1834.03Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Baci... [more]
G3P_MYCGE2.126e-1839.26Glyceraldehyde-3-phosphate dehydrogenase OS=Mycopl... [more]
G3P_THEAQ2.777e-1840.28Glyceraldehyde-3-phosphate dehydrogenase OS=Thermu... [more]
G3P_MYCLE8.079e-1835.62Glyceraldehyde-3-phosphate dehydrogenase OS=Mycoba... [more]
G3P_STRAE3.070e-1737.50Glyceraldehyde-3-phosphate dehydrogenase OS=Strept... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top