FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P2_AGABI (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Agaricus bisporus GN=gpd2 PE=3 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.500e-35
Identity = 77/142 (54.23%), Postives = 97/142 (68.31%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            VK+GINGFGRIGR+V R  LQ  D+E+VAVNDPFI  +YM YM KYDSVHG++K   ++VK+   ++ G +P+ VF  R+P  IPW   GA+YVVESTGVFT               V+ISAPS DAPM+V GVN  +Y P+
Sbjct:    2 VKVGINGFGRIGRIVLRNALQFQDIEVVAVNDPFIDLEYMAYMFKYDSVHGRFK-GTVEVKNGSFVVDG-RPMKVFAERDPAAIPWGSVGADYVVESTGVFTTIDKASAHLKGGAKKVVISAPSADAPMYVCGVNLDKYNPK 141          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_PHARH (Glyceraldehyde-3-phosphate dehydrogenase OS=Phaffia rhodozyma GN=GPD PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 7.274e-35
Identity = 74/142 (52.11%), Postives = 95/142 (66.90%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            VK+GINGFGRIGR+V R  +   D+++VA+NDPFI  +YM YM KYDS HG +K   +++KD K ++ G KP+ V+G R+P  I W   GA+YVVESTGVFT               V+ISAPS DAPMFV GVN  +Y P+
Sbjct:    3 VKVGINGFGRIGRIVLRNAIIHGDIDVVAINDPFIDLEYMVYMFKYDSTHGVFKG-SVEIKDGKLVIEG-KPIVVYGERDPANIQWGAAGADYVVESTGVFTTQEKAELHLKGGAKKVVISAPSADAPMFVCGVNLDKYDPK 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_COCHE (Glyceraldehyde-3-phosphate dehydrogenase OS=Cochliobolus heterostrophus GN=GPD1 PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 7.274e-35
Identity = 76/143 (53.15%), Postives = 94/143 (65.73%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+GINGFGRIGR+V R  ++ +DV++VAVNDPFI   Y  YM KYDS HGQ+K  ++KV D   L    K +     ++P  IPW+ETGA YVVESTGVFT               V+ISAPS DAPMFV+GVN   YKP++
Sbjct:    3 VKVGINGFGRIGRIVFRNAIEHNDVDIVAVNDPFIEPHYAAYMLKYDSTHGQFK-GDIKV-DGNNLTVNGKTIRFHMEKDPANIPWSETGAYYVVESTGVFTTTEKAKAHLKGGAKKVVISAPSPDAPMFVMGVNHETYKPDI 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_FELCA (Glyceraldehyde-3-phosphate dehydrogenase OS=Felis catus GN=GAPDH PE=2 SV=3)

HSP 1 Score: 145.591 bits (366), Expect = 1.241e-34
Identity = 74/143 (51.75%), Postives = 94/143 (65.73%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+G+NGFGRIGRLV R       V++VA+NDPFI  +YM YM +YDS HG++ H  +K ++ K ++ G KP+T+F  R+P  I W + GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKF-HGTVKAENGKLVING-KPITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_COCIM (Glyceraldehyde-3-phosphate dehydrogenase OS=Coccidioides immitis GN=GPD PE=3 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 1.241e-34
Identity = 77/143 (53.85%), Postives = 96/143 (67.13%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+GINGFGRIGR+V R  ++  +VE+VAVNDPFI T Y  YM KYDS HG++K  ++K  D+   + G K V  +  R+P  IPWAETGA+YV+ESTGVFT               VIISAPS DAPMFV+GVN   YK ++
Sbjct:    3 VKVGINGFGRIGRIVFRNAVEHPEVEIVAVNDPFIETHYAAYMLKYDSTHGRFKG-DVKFSDNGLDVDG-KHVRFYQERDPANIPWAETGADYVIESTGVFTTTEKASAHLKGGAKKVIISAPSADAPMFVMGVNNETYKSDI 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_SCLSC (Glyceraldehyde-3-phosphate dehydrogenase OS=Sclerotinia sclerotiorum GN=GPD PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.116e-34
Identity = 76/145 (52.41%), Postives = 95/145 (65.52%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            M   K+GINGFGRIGR+V R  ++ DD+++VAVNDPFI T+Y  YM KYDS HGQ+K  ++KV  D   + G+K V  +  R+P  IPWAE+ A YVVESTGVFT               V+ISAPS DAPM+V+GVN   Y  E
Sbjct:    1 MAPTKVGINGFGRIGRIVFRNAIEHDDIDIVAVNDPFIETEYAAYMLKYDSTHGQFK-GDIKVLSDGLEVNGKK-VKFYTERDPANIPWAESEAYYVVESTGVFTTTEKAKAHLKGGAKKVVISAPSADAPMYVMGVNNETYNGE 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_RAT (Glyceraldehyde-3-phosphate dehydrogenase OS=Rattus norvegicus GN=Gapdh PE=1 SV=3)

HSP 1 Score: 144.821 bits (364), Expect = 2.116e-34
Identity = 74/143 (51.75%), Postives = 95/143 (66.43%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+G+NGFGRIGRLV R     D V++VA+NDPFI  +YM YM +YDS HG++ +  +K ++ K ++ G KP+T+F  R+P  I W + GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAFSCDKVDIVAINDPFIDLNYMVYMFQYDSTHGKF-NGTVKAENGKLVING-KPITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_PICPA (Glyceraldehyde-3-phosphate dehydrogenase OS=Pichia pastoris GN=GPD PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.116e-34
Identity = 74/143 (51.75%), Postives = 94/143 (65.73%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            + +GINGFGRIGRLV RV L R D+++VA+NDPFI  +Y  YM KYDS H  +K  E+    +K  + G K +TVF  R+P  IPW + G +YV+ESTGVFT               V+I+APSKDAPMFVVGVNE +Y  +L
Sbjct:    3 ITVGINGFGRIGRLVLRVALSRADIKVVAINDPFIAPEYAAYMFKYDSTHKAYKG-EVSASGNKINIDG-KEITVFQERDPVNIPWGKAGVDYVIESTGVFTTLEGAQKHIDAGAKKVVITAPSKDAPMFVVGVNEEKYTSDL 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_PHACH (Glyceraldehyde-3-phosphate dehydrogenase OS=Phanerochaete chrysosporium GN=GPD PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.116e-34
Identity = 77/139 (55.40%), Postives = 91/139 (65.47%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 497
            VK GINGFGRIGR+V R  L   D+++VAVNDPFI  +YM YM KYDSVHG++K   ++ KD K  + G KP+ VF  ++P  IPW   GAEY+VESTGVFT               VIISAPS DAPMFV GVN   Y
Sbjct:    3 VKAGINGFGRIGRIVLRNALLHGDIDVVAVNDPFIDLEYMVYMFKYDSVHGRFK-GSVEAKDGKLYVEG-KPIHVFAEKDPANIPWGSVGAEYIVESTGVFTTTEKASAHLKGVCKKVIISAPSADAPMFVCGVNLDAY 139          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_MOUSE (Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus GN=Gapdh PE=1 SV=2)

HSP 1 Score: 144.821 bits (364), Expect = 2.116e-34
Identity = 75/143 (52.45%), Postives = 95/143 (66.43%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+G+NGFGRIGRLV R  +    VE+VA+NDPFI  +YM YM +YDS HG++ +  +K ++ K ++ G KP+T+F  R+P  I W E GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKF-NGTVKAENGKLVING-KPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSL 142          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3P2_AGABI2.500e-3554.23Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Agar... [more]
G3P_PHARH7.274e-3552.11Glyceraldehyde-3-phosphate dehydrogenase OS=Phaffi... [more]
G3P_COCHE7.274e-3553.15Glyceraldehyde-3-phosphate dehydrogenase OS=Cochli... [more]
G3P_FELCA1.241e-3451.75Glyceraldehyde-3-phosphate dehydrogenase OS=Felis ... [more]
G3P_COCIM1.241e-3453.85Glyceraldehyde-3-phosphate dehydrogenase OS=Coccid... [more]
G3P_SCLSC2.116e-3452.41Glyceraldehyde-3-phosphate dehydrogenase OS=Sclero... [more]
G3P_RAT2.116e-3451.75Glyceraldehyde-3-phosphate dehydrogenase OS=Rattus... [more]
G3P_PICPA2.116e-3451.75Glyceraldehyde-3-phosphate dehydrogenase OS=Pichia... [more]
G3P_PHACH2.116e-3455.40Glyceraldehyde-3-phosphate dehydrogenase OS=Phaner... [more]
G3P_MOUSE2.116e-3452.45Glyceraldehyde-3-phosphate dehydrogenase OS=Mus mu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top