FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_CRIGR (Glyceraldehyde-3-phosphate dehydrogenase OS=Cricetulus griseus GN=GAPDH PE=2 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 1.372e-33
Identity = 74/143 (51.75%), Postives = 94/143 (65.73%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+G+NGFGRIGRLV R       VE+VA+NDPFI  +YM YM +YDS HG++K   +K ++ K ++ G K +T+F  R+P  I W + GAEYVVESTGVFT               VIISAPS DAPMFV+GVN+ +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAFTSGKVEVVAINDPFIDLNYMVYMFQYDSTHGKFKG-TVKAENGKLVING-KAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNQDKYDNSL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_CHICK (Glyceraldehyde-3-phosphate dehydrogenase OS=Gallus gallus GN=GAPDH PE=2 SV=3)

HSP 1 Score: 142.124 bits (357), Expect = 1.372e-33
Identity = 74/143 (51.75%), Postives = 93/143 (65.03%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+G+NGFGRIGRLV R  +    V++VA+NDPFI  +YM YM KYDS HG +K   +K ++ K ++ G   +T+F  R+P  I WA+ GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAVLSGKVQVVAINDPFIDLNYMVYMFKYDSTHGHFKG-TVKAENGKLVINGHA-ITIFQERDPSNIKWADAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDKSL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_DANRE (Glyceraldehyde-3-phosphate dehydrogenase OS=Danio rerio GN=gapdh PE=2 SV=2)

HSP 1 Score: 141.739 bits (356), Expect = 1.792e-33
Identity = 75/143 (52.45%), Postives = 91/143 (63.64%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+GINGFGRIGRLV R       VE+VA+NDPFI  DYM YM +YDS HG++K  E+K +  K ++ G   +TV+  R+P  I W + GA YVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGINGFGRIGRLVTRAAFLTKKVEIVAINDPFIDLDYMVYMFQYDSTHGKYK-GEVKAEGGKLVIDGH-AITVYSERDPANIKWGDAGATYVVESTGVFTTIEKASAHIKGGAKRVIISAPSADAPMFVMGVNHEKYDNSL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_RABIT (Glyceraldehyde-3-phosphate dehydrogenase OS=Oryctolagus cuniculus GN=GAPDH PE=1 SV=3)

HSP 1 Score: 141.354 bits (355), Expect = 2.340e-33
Identity = 73/143 (51.05%), Postives = 92/143 (64.34%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+G+NGFGRIGRLV R       V++VA+NDPFI   YM YM +YDS HG++ H  +K ++ K ++ G K +T+F  R+P  I W + GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAFNSGKVDVVAINDPFIDLHYMVYMFQYDSTHGKF-HGTVKAENGKLVING-KAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_MONAN (Glyceraldehyde-3-phosphate dehydrogenase OS=Monascus anka GN=GPD1 PE=3 SV=3)

HSP 1 Score: 141.354 bits (355), Expect = 2.340e-33
Identity = 71/142 (50.00%), Postives = 92/142 (64.79%), Query Frame = 3
Query:   84 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            K+GINGFGRIGR+V R  ++ + V++VAVNDPFI   Y  YM KYDS HG++  +     D  TL+   K +  +  R+P +IPW+ETGAEYVVESTGVFT               VIISAPS D+PMFV+GVN  +Y  ++
Sbjct:    5 KVGINGFGRIGRIVFRNAIEHEGVDIVAVNDPFIEVHYAAYMLKYDSTHGRF--NGTVEFDGNTLIVNGKKIKFYAERDPAQIPWSETGAEYVVESTGVFTKQEKASLHLKGGAKKVIISAPSSDSPMFVMGVNNDQYTKDI 144          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_CHLRE (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Chlamydomonas reinhardtii GN=GAPC PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.340e-33
Identity = 72/143 (50.35%), Postives = 88/143 (61.54%), Query Frame = 3
Query:   75 GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKP 503
            GK+KIGINGFGRIGRLV R  + R D+E+VA+NDPFI  +YM YM KYDSVH  W  H    KD    L   + +  F   +P +I W   GA+ V+ESTGVFT               VII+APS DAPM+V+GVN  +Y P
Sbjct:    3 GKIKIGINGFGRIGRLVMRATMLRPDIEVVAINDPFIDAEYMAYMFKYDSVHKTWPGHVNGSKDG--FLVEGRKIHTFTESDPSKINWGAAGADIVIESTGVFTDIAKATAHLTGGAKKVIITAPSNDAPMYVMGVNHEKYNP 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_SPECI (Glyceraldehyde-3-phosphate dehydrogenase OS=Spermophilus citellus GN=GAPDH PE=2 SV=3)

HSP 1 Score: 140.969 bits (354), Expect = 3.056e-33
Identity = 72/143 (50.35%), Postives = 93/143 (65.03%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+G+NGFGRIGRLV R       V++VA+NDPFI  +YM YM +YDS HG++ H  +K ++ K ++ G K +++F  R+P  I W + GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKF-HGTVKAENGKLVING-KSISIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_MUSPF (Glyceraldehyde-3-phosphate dehydrogenase OS=Mustela putorius furo GN=GAPDH PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.056e-33
Identity = 72/143 (50.35%), Postives = 93/143 (65.03%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+G+NGFGRIGRLV R       V++VA+NDPFI  +YM YM +YDS HG++ H  +K ++ K ++ G K +++F  R+P  I W + GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKF-HGTVKAENGKLVING-KSISIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSL 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_HOMAM (Glyceraldehyde-3-phosphate dehydrogenase OS=Homarus americanus PE=1 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 3.056e-33
Identity = 76/142 (53.52%), Postives = 94/142 (66.20%), Query Frame = 3
Query:   84 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            KIGINGFGRIGRLV R  L     ++VAVNDPFI  +YM YM KYDS HG +K  E+K++D   ++ G+K +TVF    PE IPW++ GAEY+VESTGVFT               V+ISAPS DAPMFV GVN  +Y  ++
Sbjct:    2 KIGINGFGRIGRLVLRAALSCG-AQVVAVNDPFIALEYMVYMFKYDSTHGVFKG-EVKMEDGALVVDGKK-ITVFNEMKPENIPWSKAGAEYIVESTGVFTTIEKASAHFKGGAKKVVISAPSADAPMFVCGVNLEKYSKDM 140          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_COLLI (Glyceraldehyde-3-phosphate dehydrogenase OS=Columba livia GN=GAPDH PE=2 SV=3)

HSP 1 Score: 140.969 bits (354), Expect = 3.056e-33
Identity = 73/143 (51.05%), Postives = 93/143 (65.03%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VK+G+NGFGRIGRLV R  +    V++VA+NDPFI  +YM YM KYDS HG ++   +K ++ K ++ G   +T+F  R+P  I WA+ GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    2 VKVGVNGFGRIGRLVTRAAILSAKVQVVAINDPFIDLNYMVYMFKYDSTHGHFRG-TVKAENGKLVINGNA-ITIFQERDPSNIKWADAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDKSL 142          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3P_CRIGR1.372e-3351.75Glyceraldehyde-3-phosphate dehydrogenase OS=Cricet... [more]
G3P_CHICK1.372e-3351.75Glyceraldehyde-3-phosphate dehydrogenase OS=Gallus... [more]
G3P_DANRE1.792e-3352.45Glyceraldehyde-3-phosphate dehydrogenase OS=Danio ... [more]
G3P_RABIT2.340e-3351.05Glyceraldehyde-3-phosphate dehydrogenase OS=Orycto... [more]
G3P_MONAN2.340e-3350.00Glyceraldehyde-3-phosphate dehydrogenase OS=Monasc... [more]
G3PC_CHLRE2.340e-3350.35Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3P_SPECI3.056e-3350.35Glyceraldehyde-3-phosphate dehydrogenase OS=Spermo... [more]
G3P_MUSPF3.056e-3350.35Glyceraldehyde-3-phosphate dehydrogenase OS=Mustel... [more]
G3P_HOMAM3.056e-3353.52Glyceraldehyde-3-phosphate dehydrogenase OS=Homaru... [more]
G3P_COLLI3.056e-3351.05Glyceraldehyde-3-phosphate dehydrogenase OS=Columb... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top