FC876305
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC876305 vs. ExPASy Swiss-Prot
Match: THS2_ARAHY (Putative stilbene synthase 2 (Fragment) OS=Arachis hypogaea PE=5 SV=1) HSP 1 Score: 112.464 bits (280), Expect = 1.052e-24 Identity = 51/68 (75.00%), Postives = 58/68 (85.29%), Query Frame = 1 Query: 277 LKENPNMCAYMAPSLDARQDIVVVEVPKFGKEVATKVIKEWGQPKSKITHLIFCITSGVDMPGAYYQL 480 LKENPNMCAY APSLDAR+D+++ EVP+ GKE ATK IKEWGQP SKITHLIFC TSGV +PG Y+L Sbjct: 1 LKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGVDYEL 68
BLAST of FC876305 vs. ExPASy Swiss-Prot
Match: CHS6_MEDSA (Chalcone synthase 6-4 (Fragment) OS=Medicago sativa GN=CHS6-4 PE=2 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 2.198e-14 Identity = 36/41 (87.80%), Postives = 36/41 (87.80%), Query Frame = 1 Query: 364 GKEVATKVIKEWGQPKSKITHLIFCITSGVDMPGAYYQLTK 486 GKE A K IKEWGQPKSKITHLIFC TSGVDMPGA YQLTK Sbjct: 2 GKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTK 42 The following BLAST results are available for this feature:
BLAST of FC876305 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 142
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC876305 ID=FC876305; Name=FC876305; organism=Citrus clementina; type=EST; length=487bpback to top |