FC876326

Overview
NameFC876326
Unique NameFC876326
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length696
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15191 contig Ccv1_Contig15191:2..697. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH5_ARATH (Cinnamyl alcohol dehydrogenase 5 OS=Arabidopsis thaliana GN=CAD5 PE=1 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.782e-53
Identity = 97/178 (54.49%), Postives = 123/178 (69.10%), Query Frame = 1
Query:  100 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            E  +   GWAARD SG+LSP+ ++ R TG +DV  ++  CGICH+DLH  KN+ G + YP+VPGHE+VG V EVGS VSKF VGD VGVGC+VG C  C  C  DLE YCPK I +Y   Y +G  T GG++   V  + FVV+IPEG  ++  APLLCAG+TVYS L  +GL +PG+
Sbjct:    5 EAERKTTGWAARDPSGILSPYTYTLRETGPEDVNIRIICCGICHTDLHQTKNDLGMSNYPMVPGHEVVGEVVEVGSDVSKFTVGDIVGVGCLVGCCGGCSPCERDLEQYCPKKIWSYNDVYINGQPTQGGFAKATVVHQKFVVKIPEGMAVEQAAPLLCAGVTVYSPLSHFGLKQPGL 182          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH1_OCIBA (Cinnamyl alcohol dehydrogenase 1 OS=Ocimum basilicum GN=CAD1 PE=1 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 3.971e-53
Identity = 97/178 (54.49%), Postives = 126/178 (70.79%), Query Frame = 1
Query:  100 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            E  +   GWAARD SGVLSP+ ++ R TG +DV  +V  CGICH+D+H IKN+ G + YP+VPGHE+VG V EVGS+V+KF+ GD VGVGC+VGSC +C  C  D+E YC K I +Y   Y DG  T GG++  MV D+ FVV+IP+G   +  APLLCAG+TVYS L  +GL + G+
Sbjct:    5 EVERKTVGWAARDPSGVLSPYEYTLRNTGPQDVYVEVMCCGICHTDVHQIKNDLGMSNYPMVPGHEVVGEVVEVGSEVTKFRAGDVVGVGCIVGSCGNCRPCNSDIEQYCNKKIWSYNDVYPDGKPTQGGFAGAMVVDQKFVVKIPDGMAPEQAAPLLCAGVTVYSPLNHFGLKQSGL 182          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH1_ARACO (Probable cinnamyl alcohol dehydrogenase 1 OS=Aralia cordata GN=CAD1 PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 7.488e-52
Identity = 96/173 (55.49%), Postives = 122/173 (70.52%), Query Frame = 1
Query:  100 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGL 618
            E  +   GWAARD SGVLSP+ ++ R TG +DV  K+ +CGICH+D+H IKN+ G + YP+VPGHE+VG V EVGS V+KFKVGD VG G +VG C++C  C  D+E YC K I +Y   Y DG  T GG+S  MV D+ FVV+IP+G   +  APLLCAG+TVYS L  +GL
Sbjct:    5 EAERKTTGWAARDPSGVLSPYTYTLRETGPEDVFIKIIYCGICHTDIHQIKNDLGASNYPMVPGHEVVGEVVEVGSDVTKFKVGDCVGDGTIVGCCKTCRPCKADVEQYCNKKIWSYNDVYTDGKPTQGGFSGHMVVDQKFVVKIPDGMAPEQAAPLLCAGVTVYSPLTHFGL 177          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH_EUCGL (Probable cinnamyl alcohol dehydrogenase OS=Eucalyptus globulus GN=CAD PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 9.780e-52
Identity = 96/178 (53.93%), Postives = 123/178 (69.10%), Query Frame = 1
Query:  100 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            E  +   GWAARD SGVLSP+ +S R TG +D+  KV  CGICHSD+H IKN+ G + YP+VPGHE+VG V EVGS+V+K++VGD+VG G +VG CRSC  C  D E YC K I  Y   Y DG  T GG++  +V  E FVV+IP+G   +  APL+CAG+TVYS L  +GL + G+
Sbjct:    5 EKERTTTGWAARDPSGVLSPYTYSLRNTGPEDLYIKVLSCGICHSDIHQIKNDLGMSHYPMVPGHEVVGEVLEVGSEVTKYRVGDRVGTGIVVGCCRSCSPCNSDQEQYCNKKIWNYNDVYTDGKPTQGGFAGEIVVGERFVVKIPDGLESEQAAPLMCAGVTVYSPLVRFGLKQSGL 182          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH_MAIZE (Probable cinnamyl alcohol dehydrogenase OS=Zea mays GN=CAD PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.277e-51
Identity = 93/175 (53.14%), Postives = 121/175 (69.14%), Query Frame = 1
Query:  109 KNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            +   GWAARD +G LSP+ ++ R TG +DV  KV +CGICH+D+H  KN  G + YP+VPGHE+VG V EVG +V+K+ VGD VGVG +VG CR C  C  ++E YC K I +Y   Y DG  T GG++ TMV D+ FVV+IP G   +  APLLCAG+TVYS L+ +GL  PG+
Sbjct:    8 RKVVGWAARDATGHLSPYSYTLRNTGPEDVVVKVLYCGICHTDIHQAKNHLGASKYPMVPGHEVVGEVVEVGPEVAKYGVGDVVGVGVIVGCCRECSPCKANVEQYCNKKIWSYNDVYTDGRPTQGGFASTMVVDQKFVVKIPAGLAPEQAAPLLCAGVTVYSPLKHFGLTNPGL 182          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH_LOLPR (Probable cinnamyl alcohol dehydrogenase OS=Lolium perenne PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.277e-51
Identity = 98/185 (52.97%), Postives = 124/185 (67.03%), Query Frame = 1
Query:   79 MGQAPEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            MG     E  K   GWAARD +G LSP+ ++ R TG +DV  KV +CGICH+DLH  KN  G + YP+VPGHE+VG V EVG +VSK+ VGD VGVG +VG CR C  C  ++E YC K I +Y   Y DG  T GG++ +MV D+ FVV+IP G   +  APLLCAG+TVYS L+ +GL  PG+
Sbjct:    1 MGSVDASE--KTITGWAARDATGHLSPYTYNLRRTGAEDVVLKVLYCGICHTDLHQTKNHLGASKYPMVPGHEVVGEVVEVGPEVSKYSVGDVVGVGVIVGCCRDCRPCKANVEQYCNKKIWSYNDVYTDGKPTQGGFAGSMVVDQKFVVKIPAGLAPEQAAPLLCAGVTVYSPLKHFGLMTPGL 183          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH2_EUCGU (Probable cinnamyl alcohol dehydrogenase 2 OS=Eucalyptus gunnii GN=CAD2 PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.277e-51
Identity = 95/178 (53.37%), Postives = 123/178 (69.10%), Query Frame = 1
Query:  100 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            E  +   GWAARD SGVLSP+ +S R TG +D+  KV  CG+CHSD+H IKN+ G + YP+VPGHE+VG V EVGS+V+K++VGD+VG G +VG CRSC  C  D E YC K I  Y   Y DG  T GG++  +V  E FVV+IP+G   +  APL+CAG+TVYS L  +GL + G+
Sbjct:    5 EKERTTTGWAARDPSGVLSPYTYSLRNTGPEDLYIKVLSCGVCHSDIHQIKNDLGMSHYPMVPGHEVVGEVLEVGSEVTKYRVGDRVGTGIVVGCCRSCSPCNSDQEQYCNKKIWNYNDVYTDGKPTQGGFAGEIVVGERFVVKIPDGLESEQAAPLMCAGVTVYSPLVRFGLKQSGL 182          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH_POPDE (Probable cinnamyl alcohol dehydrogenase OS=Populus deltoides PE=2 SV=2)

HSP 1 Score: 202.601 bits (514), Expect = 1.668e-51
Identity = 93/178 (52.25%), Postives = 127/178 (71.35%), Query Frame = 1
Query:  100 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            E  +   GWAA D++G L+P+ +S R TG +DV  KV  CG+CH+D+H IKN+ G + YP+VPGHE+VG V EVGS V++FKVGD VGVG +VGSC++C  C  ++E YC K I +Y   Y DG  T GG++++MV  + FVVRIP+G   +  APLLCAG+TVYS L+ +GL + G+
Sbjct:    5 ETERKIVGWAATDSTGHLAPYTYSLRDTGPEDVFIKVISCGVCHTDIHQIKNDLGMSHYPMVPGHEVVGEVVEVGSDVTRFKVGDVVGVGVIVGSCKNCHPCKSEIEQYCNKKIWSYNDVYTDGKPTQGGFAESMVVHQKFVVRIPDGMSPEQAAPLLCAGLTVYSPLKHFGLKQSGL 182          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH_MEDSA (Probable cinnamyl alcohol dehydrogenase OS=Medicago sativa GN=CAD2 PE=1 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 2.179e-51
Identity = 92/175 (52.57%), Postives = 126/175 (72.00%), Query Frame = 1
Query:  109 KNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            +   G AA+D SG+L+P+ ++ R TG  DV  K+ +CG+CHSDLH IKN+ G + YP+VPGHE+VG V EVGS V++FKVG+ VGVG +VG C+SC +C  ++E YC K I +Y   Y DG IT GG++++ V ++ FVV+IPEG   +  APLLCAG+TVYS L  +GL  PG+
Sbjct:    9 RTTVGLAAKDPSGILTPYTYTLRNTGPDDVYIKIHYCGVCHSDLHQIKNDLGMSNYPMVPGHEVVGEVLEVGSNVTRFKVGEIVGVGLLVGCCKSCRACDSEIEQYCNKKIWSYNDVYTDGKITQGGFAESTVVEQKFVVKIPEGLAPEQVAPLLCAGVTVYSPLSHFGLKTPGL 183          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH1_ORYSJ (Probable cinnamyl alcohol dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=CAD1 PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 2.179e-51
Identity = 91/173 (52.60%), Postives = 122/173 (70.52%), Query Frame = 1
Query:  112 NAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            N   WAARD SG+LSP+ F+RRA    DV+ ++THCG+C++D+   +N   N++YP+VPGHEI GVVTEVG+ V  FKVGD VGVG  V SCR C++C   LENYC + + T+     DGT+T GGYS  +V  E +  +IP+G PL+  APLLCAGITVYS +  + +++PG
Sbjct:    9 NCDAWAARDPSGILSPYKFNRRAVQSDDVSLRITHCGVCYADVAWTRNILNNSMYPLVPGHEIAGVVTEVGADVKSFKVGDHVGVGTYVNSCRDCENCNSSLENYCSQHVFTFNGVDTDGTVTKGGYSTHIVVHERYCFKIPDGYPLEKAAPLLCAGITVYSPMMRHNMNQPG 181          
The following BLAST results are available for this feature:
BLAST of FC876326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
CADH5_ARATH1.782e-5354.49Cinnamyl alcohol dehydrogenase 5 OS=Arabidopsis th... [more]
CADH1_OCIBA3.971e-5354.49Cinnamyl alcohol dehydrogenase 1 OS=Ocimum basilic... [more]
CADH1_ARACO7.488e-5255.49Probable cinnamyl alcohol dehydrogenase 1 OS=Arali... [more]
CADH_EUCGL9.780e-5253.93Probable cinnamyl alcohol dehydrogenase OS=Eucalyp... [more]
CADH_MAIZE1.277e-5153.14Probable cinnamyl alcohol dehydrogenase OS=Zea may... [more]
CADH_LOLPR1.277e-5152.97Probable cinnamyl alcohol dehydrogenase OS=Lolium ... [more]
CADH2_EUCGU1.277e-5153.37Probable cinnamyl alcohol dehydrogenase 2 OS=Eucal... [more]
CADH_POPDE1.668e-5152.25Probable cinnamyl alcohol dehydrogenase OS=Populus... [more]
CADH_MEDSA2.179e-5152.57Probable cinnamyl alcohol dehydrogenase OS=Medicag... [more]
CADH1_ORYSJ2.179e-5152.60Probable cinnamyl alcohol dehydrogenase 1 OS=Oryza... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D08EF DevOvary1 Citrus clementina cDNA clone C32003D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876326 ID=FC876326|Name=FC876326|organism=Citrus clementina|type=EST|length=696bp
GATTGCACCTTGTTTATTCAAATACCCTGGACGTCAAACTAAGCCAACAA
GCACCAATATCATTAAATTCATTCTGAAATGGGGCAAGCACCGGAGCAAG
AGCACCCTAAGAACGCCTTTGGATGGGCTGCCAGGGACACTTCTGGCGTT
CTCTCCCCCTTTCACTTCTCCAGAAGAGCAACGGGAGAGAAGGATGTGAC
ATTCAAAGTAACTCACTGTGGGATATGCCATTCAGATCTTCACTTGATCA
AAAATGAATGGGGCAATGCCATTTACCCAATCGTCCCCGGACATGAGATT
GTGGGCGTAGTGACAGAGGTCGGAAGCAAAGTGAGTAAATTCAAAGTCGG
AGACAAAGTGGGAGTAGGATGCATGGTGGGATCATGCCGCTCTTGTGATA
GCTGCGCCATTGATCTTGAGAACTACTGCCCCAAAGTTATAATGACCTAT
GCCAGCAAGTACCATGATGGAACCATCACATACGGAGGCTACTCTGACAC
TATGGTTGCCGATGAGCACTTTGTGGTCCGTATTCCTGAAGGCGCACCAC
TTGACGCCACTGCCCCTCTCCTCTGTGCTGGTATCACAGTCTACAGTCTG
TTGAGATTCTATGGACTCGACAAGCCTGGTATGCATGTGGGTGTTGTCGG
CTTGGGCGGTCTAGGCCATGTCGCTGTCAAATCGCAAGGCTATGGG
back to top