FC876326

Overview
NameFC876326
Unique NameFC876326
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length696
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15191 contig Ccv1_Contig15191:2..697. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH1_EUCGU (Probable cinnamyl alcohol dehydrogenase 1 OS=Eucalyptus gunnii GN=CAD1 PE=3 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 3.716e-51
Identity = 95/178 (53.37%), Postives = 122/178 (68.54%), Query Frame = 1
Query:  100 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            E  +   GWAARD SGVLSP+ +S R TG +D+  KV  CGICHSD+H IKN+ G + YP+VPGHE+VG V EVGS+V+K++VGD+VG G +VG CRSC  C  D E YC K I  Y   Y DG  T GG++  +V  E FVV+IP+G   +  APL+CAG+TVY  L  +GL + G+
Sbjct:    5 EKERTTTGWAARDPSGVLSPYTYSLRNTGPEDLYIKVLSCGICHSDIHQIKNDLGMSHYPMVPGHEVVGEVLEVGSEVTKYRVGDRVGTGIVVGCCRSCSPCNSDQEQYCNKKIWNYNDVYTDGKPTQGGFAGEIVVGERFVVKIPDGLESEQAAPLMCAGVTVYRPLVRFGLKQSGL 182          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH_SACOF (Probable cinnamyl alcohol dehydrogenase OS=Saccharum officinarum GN=CAD PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 8.279e-51
Identity = 91/175 (52.00%), Postives = 122/175 (69.71%), Query Frame = 1
Query:  109 KNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            +   GWAARD +G L+P+ ++ R+TG +DV  KV +CGICH+D+H  KN  G + YP+VPGHE+VG V EVG +V+K+ VGD VGVG +VG CR C  C  ++E YC K I +Y   Y DG  T GG++ TMV D+ FV++IP G   +  APLLCAG+TVYS L+ +GL  PG+
Sbjct:    8 RKVVGWAARDATGHLAPYTYTLRSTGPEDVVVKVLYCGICHTDIHQAKNHLGASKYPMVPGHEVVGEVVEVGPEVTKYGVGDVVGVGVIVGCCRECKPCKANVEQYCNKKIWSYNDVYTDGRPTQGGFASTMVVDQKFVMKIPAGLAPEQAAPLLCAGVTVYSPLKAFGLTTPGL 182          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH2_ORYSJ (Cinnamyl alcohol dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=CAD2 PE=1 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 8.279e-51
Identity = 92/175 (52.57%), Postives = 120/175 (68.57%), Query Frame = 1
Query:  109 KNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            K   GWAARD SG L+P++++ R TG +DV  KV +CGICH+D+H  KN  G + YP+VPGHE+VG V EVG +V+K+  GD VGVG +VG CR C  C  ++E YC K I +Y   Y DG  T GG++  MV D+ FVV+IP G   +  APLLCAG+TVYS L+ +GL  PG+
Sbjct:    8 KTVTGWAARDASGHLTPYNYTLRKTGPEDVVVKVLYCGICHTDIHQAKNHLGASKYPMVPGHEVVGEVVEVGPEVTKYSAGDVVGVGVIVGCCRECHPCKANVEQYCNKRIWSYNDVYTDGRPTQGGFASAMVVDQKFVVKIPAGLAPEQAAPLLCAGLTVYSPLKHFGLMSPGL 182          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH4_ORYSJ (Putative cinnamyl alcohol dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CAD4 PE=3 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 3.479e-49
Identity = 87/173 (50.29%), Postives = 122/173 (70.52%), Query Frame = 1
Query:  112 NAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            N   WAARD SG+LSP+ F+RR    +DV+ ++THCG+C++D+   +N + ++IYP+VPGHEI GVVTEVG+ V  FKVGD VGVG  V SC+ C++C   LEN+C K ++TY S   DGT+T GGYS  ++  + +  +IP   PL   APLLCAGITVY+ +  + +++PG
Sbjct:    9 NCDAWAARDPSGILSPYKFNRREVQSEDVSLRITHCGVCYADVIWTRNMFNDSIYPLVPGHEIAGVVTEVGADVKGFKVGDHVGVGVYVNSCQDCENCNSSLENHCSKCVVTYNSVDSDGTVTKGGYSSHILVHQRYCFKIPADYPLSKAAPLLCAGITVYTPMIRHNMNQPG 181          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH_EUCBO (Probable cinnamyl alcohol dehydrogenase OS=Eucalyptus botryoides GN=CAD1 PE=3 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.322e-48
Identity = 93/178 (52.25%), Postives = 122/178 (68.54%), Query Frame = 1
Query:  100 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            E  +   GWAARD SGVLSP+ +S R TG +D+  KV  CGICHSD+H IKN+ G + YP+VPGHE+VG V EVGS+V+K++VGD+VG G +VG CRSC  C  D E YC K I  Y   Y DG  T GG++  +V  + FVV+IP+G   +  A ++CAG+TVYS L  +GL + G+
Sbjct:    5 EKERTTTGWAARDPSGVLSPYTYSLRNTGPEDLYIKVLSCGICHSDIHQIKNDLGMSHYPMVPGHEVVGEVLEVGSEVTKYRVGDRVGTGIVVGCCRSCGPCNSDQEQYCNKKIWNYNDVYTDGKPTQGGFAGEIVVGQRFVVKIPDGLESEQDA-VMCAGVTVYSPLVRFGLKQSGL 181          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADHC_MYCTU (NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis GN=adhC PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 6.789e-45
Identity = 87/164 (53.05%), Postives = 110/164 (67.07%), Query Frame = 1
Query:  124 WAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYC-PKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFY 612
            +AA   +  L+    +RR  G  DV   +   GICHSD+H +K EWG   YP+VPGHEI GVVT VGS+V+K++ GD+VGVGC V SCR C+SC   +E YC P    TY S   DG  T GGYS+ +V DE++V+RIP+  PLD  APLLCAGIT+YS LR +
Sbjct:    7 YAAMSATEPLTKTTITRRDPGPHDVAIDIKFAGICHSDIHTVKAEWGQPNYPVVPGHEIAGVVTAVGSEVTKYRQGDRVGVGCFVDSCRECNSCTRGIEQYCKPGANFTYNSIGKDGQPTQGGYSEAIVVDENYVLRIPDVLPLDVAAPLLCAGITLYSPLRHW 170          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADHC_MYCBO (NADP-dependent alcohol dehydrogenase C OS=Mycobacterium bovis GN=adhC PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 6.789e-45
Identity = 87/164 (53.05%), Postives = 110/164 (67.07%), Query Frame = 1
Query:  124 WAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYC-PKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFY 612
            +AA   +  L+    +RR  G  DV   +   GICHSD+H +K EWG   YP+VPGHEI GVVT VGS+V+K++ GD+VGVGC V SCR C+SC   +E YC P    TY S   DG  T GGYS+ +V DE++V+RIP+  PLD  APLLCAGIT+YS LR +
Sbjct:    7 YAAMSATEPLTKTTITRRDPGPHDVAIDIKFAGICHSDIHTVKAEWGQPNYPVVPGHEIAGVVTAVGSEVTKYRQGDRVGVGCFVDSCRECNSCTRGIEQYCKPGANFTYNSIGKDGQPTQGGYSEAIVVDENYVLRIPDVLPLDVAAPLLCAGITLYSPLRHW 170          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH1_ARATH (Probable cinnamyl alcohol dehydrogenase 1 OS=Arabidopsis thaliana GN=CAD1 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.158e-44
Identity = 82/169 (48.52%), Postives = 115/169 (68.05%), Query Frame = 1
Query:  124 WAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            WAARD SG+LSP   +RR+    DV+  +THCG+C++D+   +N+ G++ YP+VPGHEI G+VT+VG  V +FKVGD VGVG  V SCR C+ C    E  C K + T+    HDG++T GGYS  +V  E +  +IP   PL++ APLLCAGITVY+ +  + +++PG
Sbjct:   14 WAARDPSGLLSPHTITRRSVTTDDVSLTITHCGVCYADVIWSRNQHGDSKYPLVPGHEIAGIVTKVGPNVQRFKVGDHVGVGTYVNSCRECEYCNEGQEVNCAKGVFTFNGIDHDGSVTKGGYSSHIVVHERYCYKIPVDYPLESAAPLLCAGITVYAPMMRHNMNQPG 182          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADHA_BACSU (Probable formaldehyde dehydrogenase adhA OS=Bacillus subtilis GN=adhA PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.465e-39
Identity = 78/150 (52.00%), Postives = 98/150 (65.33%), Query Frame = 1
Query:  172 RRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPK-VIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGL 618
            RR     DV   +   GICHSD+H   +EWG  I+P+VPGHEI GVVT VG+KV+K  VGD+VGVGC V SC  C+ C    E +C K V+ TY S  +DG  TYGGYS  +V  + FVVRIP+   +D  +PLLCAGIT YS L+ + +
Sbjct:   26 RRGLRPHDVLIDIKFSGICHSDIHSAFDEWGGGIFPMVPGHEIAGVVTAVGTKVTKLAVGDRVGVGCFVDSCGECEYCLNAEEQFCTKGVVQTYNSVDYDGNPTYGGYSQKIVVTDRFVVRIPDRLEMDVASPLLCAGITTYSPLKHWNV 175          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: YAHK_ECOLI (Uncharacterized zinc-type alcohol dehydrogenase-like protein yahK OS=Escherichia coli (strain K12) GN=yahK PE=1 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 8.038e-38
Identity = 78/156 (50.00%), Postives = 97/156 (62.18%), Query Frame = 1
Query:  151 LSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGT-ITYGGYSDTMVADEHFVVRIPE-GAPLDATAPLLCAGITVYSLLRFY 612
            L P   +RR  G  DV  ++ +CG+CHSDLH +++EW   +YP VPGHEIVG V  VG +V K+  GD VGVGC+V SC+ C+ C   LENYC  +  TY S   D    T GGYS  +V  E +V+RI      L A APLLCAGIT YS LR +
Sbjct:   15 LEPMDITRREPGPNDVKIEIAYCGVCHSDLHQVRSEWAGTVYPCVPGHEIVGRVVAVGDQVEKYAPGDLVGVGCIVDSCKHCEECEDGLENYCDHMTGTYNSPTPDEPGHTLGGYSQQIVVHERYVLRIRHPQEQLAAVAPLLCAGITTYSPLRHW 170          
The following BLAST results are available for this feature:
BLAST of FC876326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
CADH1_EUCGU3.716e-5153.37Probable cinnamyl alcohol dehydrogenase 1 OS=Eucal... [more]
CADH_SACOF8.279e-5152.00Probable cinnamyl alcohol dehydrogenase OS=Sacchar... [more]
CADH2_ORYSJ8.279e-5152.57Cinnamyl alcohol dehydrogenase 2 OS=Oryza sativa s... [more]
CADH4_ORYSJ3.479e-4950.29Putative cinnamyl alcohol dehydrogenase 4 OS=Oryza... [more]
CADH_EUCBO1.322e-4852.25Probable cinnamyl alcohol dehydrogenase OS=Eucalyp... [more]
ADHC_MYCTU6.789e-4553.05NADP-dependent alcohol dehydrogenase C OS=Mycobact... [more]
ADHC_MYCBO6.789e-4553.05NADP-dependent alcohol dehydrogenase C OS=Mycobact... [more]
CADH1_ARATH1.158e-4448.52Probable cinnamyl alcohol dehydrogenase 1 OS=Arabi... [more]
ADHA_BACSU1.465e-3952.00Probable formaldehyde dehydrogenase adhA OS=Bacill... [more]
YAHK_ECOLI8.038e-3850.00Uncharacterized zinc-type alcohol dehydrogenase-li... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D08EF DevOvary1 Citrus clementina cDNA clone C32003D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876326 ID=FC876326|Name=FC876326|organism=Citrus clementina|type=EST|length=696bp
GATTGCACCTTGTTTATTCAAATACCCTGGACGTCAAACTAAGCCAACAA
GCACCAATATCATTAAATTCATTCTGAAATGGGGCAAGCACCGGAGCAAG
AGCACCCTAAGAACGCCTTTGGATGGGCTGCCAGGGACACTTCTGGCGTT
CTCTCCCCCTTTCACTTCTCCAGAAGAGCAACGGGAGAGAAGGATGTGAC
ATTCAAAGTAACTCACTGTGGGATATGCCATTCAGATCTTCACTTGATCA
AAAATGAATGGGGCAATGCCATTTACCCAATCGTCCCCGGACATGAGATT
GTGGGCGTAGTGACAGAGGTCGGAAGCAAAGTGAGTAAATTCAAAGTCGG
AGACAAAGTGGGAGTAGGATGCATGGTGGGATCATGCCGCTCTTGTGATA
GCTGCGCCATTGATCTTGAGAACTACTGCCCCAAAGTTATAATGACCTAT
GCCAGCAAGTACCATGATGGAACCATCACATACGGAGGCTACTCTGACAC
TATGGTTGCCGATGAGCACTTTGTGGTCCGTATTCCTGAAGGCGCACCAC
TTGACGCCACTGCCCCTCTCCTCTGTGCTGGTATCACAGTCTACAGTCTG
TTGAGATTCTATGGACTCGACAAGCCTGGTATGCATGTGGGTGTTGTCGG
CTTGGGCGGTCTAGGCCATGTCGCTGTCAAATCGCAAGGCTATGGG
back to top