FC876326

Overview
NameFC876326
Unique NameFC876326
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length696
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15191 contig Ccv1_Contig15191:2..697. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH_STAA8 (Alcohol dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=adh PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.475e-15
Identity = 44/152 (28.95%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  175 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++   + KPG
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNV-KPG 162          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH_STAA3 (Alcohol dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=adh PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.475e-15
Identity = 44/152 (28.95%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  175 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++   + KPG
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNV-KPG 162          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADHP_ECOLI (Alcohol dehydrogenase, propanol-preferring OS=Escherichia coli (strain K12) GN=adhP PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.292e-15
Identity = 44/152 (28.95%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  175 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            R+    +   K+  CG+CH+DLH+   ++G+    ++ GHE +GVV EVG  V+  K GD+  V      C  C+ C    E  C  V        + G    GG ++  +    + V++P+G    A + + CAG+T Y  ++   + +PG
Sbjct:   20 RSLKHGEALLKMECCGVCHTDLHVKNGDFGDKT-GVILGHEGIGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSV-------KNAGYSVDGGMAEECIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKI-RPG 162          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH1_CAEEL (Alcohol dehydrogenase 1 OS=Caenorhabditis elegans GN=sodh-1 PE=1 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.631e-14
Identity = 48/141 (34.04%), Postives = 75/141 (53.19%), Query Frame = 1
Query:  187 EKDVTFKVTHCGICHSDLHLIKNEWGN-AIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            + ++  K+ + GICHSDLH+   +  + ++ P+V GHE  G V ++G  V+ +++GDK GV  M  +C +C+ C    E  C   I  Y     D + T+  Y      D     +I +   L A AP+LCAG+TVY  L+
Sbjct:   33 DDEILVKIEYSGICHSDLHVWLGDLKDMSVCPLVGGHEGAGSVVQIGKNVTGWQLGDKAGVKLMNFNCLNCEFCKKGHEPLCHH-IQNYG---FDRSGTFQEYLTIRGVD---AAKINKDTNLAAAAPILCAGVTVYKALK 166          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH1_ZYMMO (Alcohol dehydrogenase 1 OS=Zymomonas mobilis GN=adhA PE=1 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 8.094e-14
Identity = 38/138 (27.54%), Postives = 67/138 (48.55%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLR 606
            +   ++ +CG+CH+DLH+   ++G+    I  GHE +G+V +VG  V+  KVGD+  V      C  C+ C    E  C  V        + G    G  ++  +    + V++P+G      + + CAG+T Y  ++
Sbjct:   26 EALLEMEYCGVCHTDLHVKNGDFGDETGRIT-GHEGIGIVKQVGEGVTSLKVGDRASVAWFFKGCGHCEYCVSGNETLCRNV-------ENAGYTVDGAMAEECIVVADYSVKVPDGLDPAVASSITCAGVTTYKAVK 155          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: BDH1_YEAST ((R,R)-butanediol dehydrogenase OS=Saccharomyces cerevisiae GN=BDH1 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.076e-13
Identity = 50/152 (32.89%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  187 EKDVTFKVTHCGICHSDLHLIKN------------EWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSC--------------RSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATA 564
            + +V   V+ CGIC SDLH   +            +  NA  P+  GHE+ G+V++VG KV+K KVGD V V     SC              + CD+C    EN C     T+A     G I+ GG+++ +V  +H ++ +P+  PLD  A
Sbjct:   26 DDEVIIDVSWCGICGSDLHEYLDGPIFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDA-ASSCADLHCWPHSKFYNSKPCDACQRGSENLC-----THAGFVGLGVIS-GGFAEQVVVSQHHIIPVPKEIPLDVAA 170          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH1_RANPE (Alcohol dehydrogenase 1 OS=Rana perezi PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.017e-13
Identity = 52/160 (32.50%), Postives = 72/160 (45.00%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPK--------VIMTYASKYH------DGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            +V  K+   GIC SD H+I     +  +P++ GHE  GVV  VG  V+KFK GDKV +   V  C  C  C     N C K        V++   S++          I+   +++  V DE  V +I E APL+    + C   T Y      G  KPG
Sbjct:   35 EVRVKIVATGICRSDDHVISGALSDMKFPVILGHEAAGVVESVGEGVTKFKPGDKV-IPLFVPQCGECRCCKNPESNLCYKNDIGKYDGVLLDKTSRFTCKGKSIHNFISTSTFTEYTVLDEIAVAKIHEDAPLEKVCLIGCGFSTGYGSAVNTGKVKPG 193          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH_SULAC (NAD-dependent alcohol dehydrogenase OS=Sulfolobus acidocaldarius GN=adh PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.852e-13
Identity = 52/155 (33.55%), Postives = 71/155 (45.81%), Query Frame = 1
Query:  184 GEKDVTFKVTHCGICHSDLHLIKNEWGNAI------YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYC--PKVIMTYASKYHDGTITYGGYSD-TMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLD 621
            G   V  KV + G+CH+DL +      N I       P+V GHEI G V E+G  V  FK  DKV +   +G   SC  C I  + YC  PK +         G    GGY +  +V D  ++ ++         +PL C+G+T Y  LR   LD
Sbjct:   24 GVGQVLVKVDYAGVCHTDLSVRSGAIFNRISSSKPTLPLVIGHEIAGEVVELGGNVEGFKKSDKVLIDPWIGD-GSCHYCKIGEDQYCDNPKWL---------GINVNGGYGEYVLVPDYRYMFKL-RNLSTSTASPLACSGVTAYRALRLANLD 167          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH6_RAT (Alcohol dehydrogenase 6 OS=Rattus norvegicus GN=Adh6 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.604e-12
Identity = 44/148 (29.73%), Postives = 69/148 (46.62%), Query Frame = 1
Query:  190 KDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGT-------------ITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVY 594
            K+V  K+   G+C +D+  +  +  +   P++ GHE VG+V  VG  VS  + GDKV + C +  C  C +C     N C ++ ++      +GT             I  G +S+  V  E  V +I EGAPL+    + C   T Y
Sbjct:   35 KEVRIKMVATGVCGTDIKHLDTQELSKFCPMIMGHEGVGIVESVGEGVSSVRTGDKVILLC-IPQCGECKTCLNSKNNICTEIRLSKTHLASEGTSRITCKGKLVHQYIALGSFSEYTVLKEISVAKIDEGAPLEKVCIIGCGFATGY 181          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH7_HUMAN (Alcohol dehydrogenase class 4 mu/sigma chain OS=Homo sapiens GN=ADH7 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.441e-12
Identity = 47/160 (29.38%), Postives = 72/160 (45.00%), Query Frame = 1
Query:  190 KDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITY-------------GGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            K+V  K+   GIC +D H+IK    +  +P++ GHE  G+V  +G  V+  K GDKV +   +  CR C++C     N C +  +T      DGT  +               +++  V DE  V +I + AP +    + C   T Y      G  KPG
Sbjct:   35 KEVRIKILATGICRTDDHVIKGTMVSK-FPVIVGHEATGIVESIGEGVTTVKPGDKV-IPLFLPQCRECNACRNPDGNLCIRSDITGRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGKVKPG 192          
The following BLAST results are available for this feature:
BLAST of FC876326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
ADH_STAA81.475e-1528.95Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]
ADH_STAA31.475e-1528.95Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]
ADHP_ECOLI4.292e-1528.95Alcohol dehydrogenase, propanol-preferring OS=Esch... [more]
ADH1_CAEEL1.631e-1434.04Alcohol dehydrogenase 1 OS=Caenorhabditis elegans ... [more]
ADH1_ZYMMO8.094e-1427.54Alcohol dehydrogenase 1 OS=Zymomonas mobilis GN=ad... [more]
BDH1_YEAST3.076e-1332.89(R,R)-butanediol dehydrogenase OS=Saccharomyces ce... [more]
ADH1_RANPE4.017e-1332.50Alcohol dehydrogenase 1 OS=Rana perezi PE=1 SV=1[more]
ADH_SULAC6.852e-1333.55NAD-dependent alcohol dehydrogenase OS=Sulfolobus ... [more]
ADH6_RAT2.604e-1229.73Alcohol dehydrogenase 6 OS=Rattus norvegicus GN=Ad... [more]
ADH7_HUMAN4.441e-1229.38Alcohol dehydrogenase class 4 mu/sigma chain OS=Ho... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D08EF DevOvary1 Citrus clementina cDNA clone C32003D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876326 ID=FC876326|Name=FC876326|organism=Citrus clementina|type=EST|length=696bp
GATTGCACCTTGTTTATTCAAATACCCTGGACGTCAAACTAAGCCAACAA
GCACCAATATCATTAAATTCATTCTGAAATGGGGCAAGCACCGGAGCAAG
AGCACCCTAAGAACGCCTTTGGATGGGCTGCCAGGGACACTTCTGGCGTT
CTCTCCCCCTTTCACTTCTCCAGAAGAGCAACGGGAGAGAAGGATGTGAC
ATTCAAAGTAACTCACTGTGGGATATGCCATTCAGATCTTCACTTGATCA
AAAATGAATGGGGCAATGCCATTTACCCAATCGTCCCCGGACATGAGATT
GTGGGCGTAGTGACAGAGGTCGGAAGCAAAGTGAGTAAATTCAAAGTCGG
AGACAAAGTGGGAGTAGGATGCATGGTGGGATCATGCCGCTCTTGTGATA
GCTGCGCCATTGATCTTGAGAACTACTGCCCCAAAGTTATAATGACCTAT
GCCAGCAAGTACCATGATGGAACCATCACATACGGAGGCTACTCTGACAC
TATGGTTGCCGATGAGCACTTTGTGGTCCGTATTCCTGAAGGCGCACCAC
TTGACGCCACTGCCCCTCTCCTCTGTGCTGGTATCACAGTCTACAGTCTG
TTGAGATTCTATGGACTCGACAAGCCTGGTATGCATGTGGGTGTTGTCGG
CTTGGGCGGTCTAGGCCATGTCGCTGTCAAATCGCAAGGCTATGGG
back to top