FC877822
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC877822 vs. ExPASy Swiss-Prot
Match: DRE2G_ARATH (Dehydration-responsive element-binding protein 2G OS=Arabidopsis thaliana GN=DREB2G PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 1.545e-11 Identity = 32/55 (58.18%), Postives = 40/55 (72.73%), Query Frame = 2 Query: 299 YRGVRMRAWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGASAILN 463 +RGVR R WGKWV+EIREP + +R+WLGTF+T AA A+D AA + G A LN Sbjct: 34 FRGVRQRTWGKWVAEIREPNRGTRLWLGTFNTSVEAAMAYDEAAKKLYGHEAKLN 88
BLAST of FC877822 vs. ExPASy Swiss-Prot
Match: ERF88_ARATH (Ethylene-responsive transcription factor ERF088 OS=Arabidopsis thaliana GN=ERF088 PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 2.636e-11 Identity = 35/73 (47.95%), Postives = 45/73 (61.64%), Query Frame = 2 Query: 248 AAKKQKKRPRDDSKHPVYRGVRMRAWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGASAILNF 466 ++ K+K + + Y GVR R WG++ +EIR P K R WLGTF T E AA A+DVAA SI G+ A NF Sbjct: 4 SSNKRKSKEEKKLQEGKYLGVRRRPWGRYAAEIRNPFTKERHWLGTFDTAEEAAFAYDVAARSISGSLATTNF 76
BLAST of FC877822 vs. ExPASy Swiss-Prot
Match: DRE2E_ARATH (Dehydration-responsive element-binding protein 2E OS=Arabidopsis thaliana GN=DREB2E PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 2.636e-11 Identity = 40/87 (45.98%), Postives = 52/87 (59.77%), Query Frame = 2 Query: 251 AKKQKKRPRDDSKHPV--YRGVRMRAWGKWVSEIREP--------RKKSRIWLGTFSTPEMAARAHDVAALSIKGASAILNFPKLAG 481 +KK R + ++PV +RGVR R WGKWV+EIREP + R+WLGTF+T AA A+D AA + G A LNFP+ G Sbjct: 52 SKKGCMRGKGGPENPVCRFRGVRQRVWGKWVAEIREPVSHRGANSSRSKRLWLGTFATAAEAALAYDRAASVMYGPYARLNFPEDLG 138
BLAST of FC877822 vs. ExPASy Swiss-Prot
Match: ESR1_ARATH (Ethylene-responsive transcription factor ESR1 OS=Arabidopsis thaliana GN=ESR1 PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 3.442e-11 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 2 Query: 299 YRGVRMRAWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGASAILNF 466 YRGVR R WG++ +EIR+P K R WLGTF T E AA A+D AA + +GA A NF Sbjct: 57 YRGVRRRPWGRYAAEIRDPMSKERRWLGTFDTAEQAACAYDSAARAFRGAKARTNF 112
BLAST of FC877822 vs. ExPASy Swiss-Prot
Match: ERF92_ARATH (Ethylene-responsive transcription factor 1B OS=Arabidopsis thaliana GN=ERF1B PE=2 SV=2) HSP 1 Score: 68.9366 bits (167), Expect = 4.496e-11 Identity = 33/57 (57.89%), Postives = 43/57 (75.44%), Query Frame = 2 Query: 299 YRGVRMRAWGKWVSEIREPRKKS-RIWLGTFSTPEMAARAHDVAALSIKGASAILNF 466 YRGVR R WGK+ +EIR+ + R+WLGTF + E AA A+D AA S++G+SAILNF Sbjct: 82 YRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAFSMRGSSAILNF 138
BLAST of FC877822 vs. ExPASy Swiss-Prot
Match: ERF1_SOLLC (Ethylene-responsive transcription factor 1 OS=Solanum lycopersicum GN=ERF1 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 4.496e-11 Identity = 32/62 (51.61%), Postives = 43/62 (69.35%), Query Frame = 2 Query: 299 YRGVRMRAWGKWVSEIREPRKK-SRIWLGTFSTPEMAARAHDVAALSIKGASAILNFPKLAG 481 YRGVR R WGK+ +EIR+P K +R+WLGT+ + E AA A+ AA ++G A+LNFP G Sbjct: 107 YRGVRQRPWGKFAAEIRDPAKNGARVWLGTYESAEEAALAYGKAAFRMRGTKALLNFPHRIG 168
BLAST of FC877822 vs. ExPASy Swiss-Prot
Match: ERF87_ARATH (Ethylene-responsive transcription factor ERF087 OS=Arabidopsis thaliana GN=ERF087 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 5.872e-11 Identity = 36/83 (43.37%), Postives = 51/83 (61.45%), Query Frame = 2 Query: 254 KKQKKRPRDDSKHPVYRGVRMRAWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGASAILNFPKLAGSLPRPAS 502 ++ + +P+ + Y GVR R WG++ +EIR P K R WLGTF T E AA A+D AA SI+G +A NF + +PR +S Sbjct: 24 QQPQPQPQQHIEEIKYVGVRRRPWGRYAAEIRNPTTKERYWLGTFDTAEEAALAYDRAARSIRGLTARTNF--VYSDMPRGSS 104
BLAST of FC877822 vs. ExPASy Swiss-Prot
Match: LEP_ARATH (Ethylene-responsive transcription factor LEP OS=Arabidopsis thaliana GN=LEP PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 7.668e-11 Identity = 33/69 (47.83%), Postives = 44/69 (63.77%), Query Frame = 2 Query: 260 QKKRPRDDSKHPVYRGVRMRAWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGASAILNF 466 + K+ +DD + GVR R WG++ +EIR+P K R WLGTF T E AA A+D AA S++G A NF Sbjct: 7 KSKKKQDDQVGTRFLGVRRRPWGRYAAEIRDPTTKERHWLGTFDTAEEAALAYDRAARSMRGTRARTNF 75 The following BLAST results are available for this feature:
BLAST of FC877822 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 138
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC877822 ID=FC877822; Name=FC877822; organism=Citrus clementina; type=EST; length=919bpback to top |