FC878354
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC878354 vs. ExPASy Swiss-Prot
Match: AGD7_ARATH (ADP-ribosylation factor GTPase-activating protein AGD7 OS=Arabidopsis thaliana GN=AGD7 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 6.845e-11 Identity = 32/69 (46.38%), Postives = 41/69 (59.42%), Query Frame = 1 Query: 490 NDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANS 696 N C DC P WAS++ G+ +C+ECSG HR LGVHIS VRS+T+D W I + GN N+ Sbjct: 16 NKVCVDCSQKNPQWASISYGIFMCLECSGKHRGLGVHISFVRSVTMD--SWSEIQIKKMDAGGNERLNN 82
BLAST of FC878354 vs. ExPASy Swiss-Prot
Match: ARFG1_HUMAN (ADP-ribosylation factor GTPase-activating protein 1 OS=Homo sapiens GN=ARFGAP1 PE=1 SV=2) HSP 1 Score: 67.781 bits (164), Expect = 8.940e-11 Identity = 35/95 (36.84%), Postives = 56/95 (58.95%), Query Frame = 1 Query: 448 KSEKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQSRSAF 732 ++ K + +R N+ C +CGA P W S+ G+ +C+ECSG HR LGVH+S VRS+T+D W+ + ++ GNA + E L+S+ + Sbjct: 5 RTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMD--KWKDIELEKMKAGGNA----KFREFLESQEDY 93 The following BLAST results are available for this feature:
BLAST of FC878354 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 92
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC878354 ID=FC878354; Name=FC878354; organism=Citrus clementina; type=EST; length=852bpback to top |