FC910033
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DJB11_RAT (DnaJ homolog subfamily B member 11 OS=Rattus norvegicus GN=Dnajb11 PE=2 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.854e-13 Identity = 33/69 (47.83%), Postives = 53/69 (76.81%), Query Frame = 3 Query: 522 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKN-KAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSD 725 +DFY+ILGV RS +++D++K+YRKL+L++HPD+N P A+E F+ + A++ LS+ E RK+YD G + Sbjct: 24 RDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEE 92
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DJB11_PONAB (DnaJ homolog subfamily B member 11 OS=Pongo abelii GN=DNAJB11 PE=2 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.854e-13 Identity = 33/69 (47.83%), Postives = 53/69 (76.81%), Query Frame = 3 Query: 522 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKN-KAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSD 725 +DFY+ILGV RS +++D++K+YRKL+L++HPD+N P A+E F+ + A++ LS+ E RK+YD G + Sbjct: 24 RDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEE 92
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DJB11_MOUSE (DnaJ homolog subfamily B member 11 OS=Mus musculus GN=Dnajb11 PE=1 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.854e-13 Identity = 33/69 (47.83%), Postives = 53/69 (76.81%), Query Frame = 3 Query: 522 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKN-KAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSD 725 +DFY+ILGV RS +++D++K+YRKL+L++HPD+N P A+E F+ + A++ LS+ E RK+YD G + Sbjct: 24 RDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEE 92
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DJB11_HUMAN (DnaJ homolog subfamily B member 11 OS=Homo sapiens GN=DNAJB11 PE=1 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.854e-13 Identity = 33/69 (47.83%), Postives = 53/69 (76.81%), Query Frame = 3 Query: 522 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKN-KAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSD 725 +DFY+ILGV RS +++D++K+YRKL+L++HPD+N P A+E F+ + A++ LS+ E RK+YD G + Sbjct: 24 RDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEE 92
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DJB11_CANFA (DnaJ homolog subfamily B member 11 OS=Canis familiaris GN=DNAJB11 PE=1 SV=2) HSP 1 Score: 75.0998 bits (183), Expect = 4.854e-13 Identity = 33/69 (47.83%), Postives = 53/69 (76.81%), Query Frame = 3 Query: 522 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKN-KAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSD 725 +DFY+ILGV RS +++D++K+YRKL+L++HPD+N P A+E F+ + A++ LS+ E RK+YD G + Sbjct: 24 RDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDSEKRKQYDTYGEE 92
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DJB11_BOVIN (DnaJ homolog subfamily B member 11 OS=Bos taurus GN=DNAJB11 PE=2 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.854e-13 Identity = 33/69 (47.83%), Postives = 53/69 (76.81%), Query Frame = 3 Query: 522 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKN-KAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSD 725 +DFY+ILGV RS +++D++K+YRKL+L++HPD+N P A+E F+ + A++ LS+ E RK+YD G + Sbjct: 24 RDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDSEKRKQYDTYGEE 92
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DNAJ_TRIEI (Chaperone protein dnaJ OS=Trichodesmium erythraeum (strain IMS101) GN=dnaJ PE=3 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 6.339e-13 Identity = 31/66 (46.97%), Postives = 50/66 (75.76%), Query Frame = 3 Query: 522 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYDITG 719 +D+YEILGV RS E+++++YR+L+ K HPD NK PG+EE FK +++A++ LS+ E + ++D G Sbjct: 3 RDYYEILGVSRSADKEELKRAYRRLARKYHPDVNKEPGSEERFKEINRAYEILSDPEMKARFDRFG 68
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DNAJ_ROSS1 (Chaperone protein dnaJ OS=Roseiflexus sp. (strain RS-1) GN=dnaJ PE=3 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 6.339e-13 Identity = 31/74 (41.89%), Postives = 52/74 (70.27%), Query Frame = 3 Query: 522 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSDEPVYQP 743 +D+YE+LGV+R+ + ++++K++R+L+ + HPD NKAP AE FK +++A++ LS+ E R YD G P P Sbjct: 5 RDYYEVLGVQRNASQDEIKKAFRRLARQYHPDVNKAPDAEAKFKEINEAYEVLSDPEKRSMYDRFGHAGPTAAP 78
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DNAJ_ROSCS (Chaperone protein dnaJ OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=dnaJ PE=3 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 6.339e-13 Identity = 31/74 (41.89%), Postives = 52/74 (70.27%), Query Frame = 3 Query: 522 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSDEPVYQP 743 +D+YE+LGV+R+ + ++++K++R+L+ + HPD NKAP AE FK +++A++ LS+ E R YD G P P Sbjct: 5 RDYYEVLGVQRNASQDEIKKAFRRLARQYHPDVNKAPDAEAKFKEINEAYEVLSDPEKRSMYDRFGHAGPTAAP 78
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DNAJ_BACSH (Chaperone protein dnaJ OS=Bacillus sphaericus GN=dnaJ PE=3 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 6.339e-13 Identity = 31/70 (44.29%), Postives = 53/70 (75.71%), Query Frame = 3 Query: 522 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSDEP 731 +D+YE+LG+ T ++++K+YRKLS + HPD NK PGA+E FK +++A++ LS+D+ + +YD G ++P Sbjct: 4 RDYYEVLGL----TKDEIKKAYRKLSKQYHPDLNKEPGADEKFKEIAEAYEVLSDDQKKARYDQFGHEDP 69 The following BLAST results are available for this feature:
BLAST of FC910033 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 287
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC910033 ID=FC910033; Name=FC910033; organism=Citrus clementina; type=EST; length=782bpback to top |