FC910033
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DJ27A_XENLA (DnaJ homolog subfamily C member 27-A OS=Xenopus laevis GN=dnajc27-A PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 5.933e-11 Identity = 31/64 (48.44%), Postives = 48/64 (75.00%), Query Frame = 3 Query: 477 YTEEQIAIVRQIKKTKDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKA 668 +T+EQ +R+I+ KD +++LGV+ T ++V K+YRKL++ +HPDK APG+E+AFKAV A Sbjct: 201 FTKEQADSIRRIRNCKDSWDMLGVKPGATRDEVNKAYRKLAVLLHPDKCMAPGSEDAFKAVVNA 264
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DNAJ_THENN (Chaperone protein dnaJ OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 7.749e-11 Identity = 33/80 (41.25%), Postives = 54/80 (67.50%), Query Frame = 3 Query: 513 KKTKDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKN--KAPGAEEAFKAVSKAFQCLSNDESRKKYDITG--SDEPVYQ 740 ++ KD+YEILGV R+ T E++RK+Y++L + HPD++ AE+ FK + +A++ LS+ + R YD G ++PVYQ Sbjct: 3 REKKDYYEILGVPRNATQEEIRKAYKRLVKEWHPDRHPENRKEAEQRFKEIQEAYEVLSDPQKRAMYDRFGYVGEQPVYQ 82
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DNAJ_THEAC (Chaperone protein dnaJ OS=Thermoplasma acidophilum GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 7.749e-11 Identity = 33/70 (47.14%), Postives = 53/70 (75.71%), Query Frame = 3 Query: 522 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPD---KNKAPGAEEAFKAVSKAFQCLSNDESRKKYDITGS 722 KD+Y+ILGV+R+ T E+++K++R+L+ K HPD +NK AEE FK +S+A++ LS+ + R+ YD TG+ Sbjct: 3 KDYYKILGVDRNATDEEIKKAFRELAKKWHPDLHPENKQE-AEEKFKEISEAYEVLSDPQKRRMYDQTGT 71
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DNAJ_STRT2 (Chaperone protein dnaJ OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 7.749e-11 Identity = 28/67 (41.79%), Postives = 47/67 (70.15%), Query Frame = 3 Query: 525 DFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSD 725 ++Y+ LG+ + + ++++++YRKLS K HPD NK PGAEE +K + +A++ LS+ + R YD G D Sbjct: 5 EYYDRLGLSKDASQDEIKRAYRKLSKKYHPDINKEPGAEEKYKEILEAYETLSDAQKRAAYDQYGPD 71
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DNAJ_STRT1 (Chaperone protein dnaJ OS=Streptococcus thermophilus (strain CNRZ 1066) GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 7.749e-11 Identity = 28/67 (41.79%), Postives = 47/67 (70.15%), Query Frame = 3 Query: 525 DFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSD 725 ++Y+ LG+ + + ++++++YRKLS K HPD NK PGAEE +K + +A++ LS+ + R YD G D Sbjct: 5 EYYDRLGLSKDASQDEIKRAYRKLSKKYHPDINKEPGAEEKYKEILEAYETLSDAQKRAAYDQYGPD 71
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DNAJ_PSEFS (Chaperone protein dnaJ OS=Pseudomonas fluorescens (strain SBW25) GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 7.749e-11 Identity = 30/67 (44.78%), Postives = 48/67 (71.64%), Query Frame = 3 Query: 522 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKN-KAPGAEEAFKAVSKAFQCLSNDESRKKYDITG 719 +D+YE+LGVER + D++K+YR+L++K HPD+N + +EE FK ++A++CLS+ R YD G Sbjct: 4 RDYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPDSKESEEMFKEANEAYECLSDPNKRAAYDQYG 70
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DNAJ_METCA (Chaperone protein dnaJ OS=Methylococcus capsulatus GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 7.749e-11 Identity = 31/67 (46.27%), Postives = 48/67 (71.64%), Query Frame = 3 Query: 522 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNK-APGAEEAFKAVSKAFQCLSNDESRKKYDITG 719 +D+YE LGV R+ + D++K++R+L++K HPD+NK P AEE FK+V +A+ LS+ + R YD G Sbjct: 4 EDYYETLGVPRNASDSDIKKAFRRLAMKYHPDRNKDNPEAEERFKSVKEAYDVLSDPKKRSAYDQFG 70
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DNAJ_EHRCR (Chaperone protein dnaJ OS=Ehrlichia chaffeensis (strain Arkansas) GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 7.749e-11 Identity = 33/68 (48.53%), Postives = 48/68 (70.59%), Query Frame = 3 Query: 525 DFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPG---AEEAFKAVSKAFQCLSNDESRKKYDITG 719 D+Y++LGV +S T E+++K+YRK++LK HPDKN PG AEE FK +S+A+ L + + R YD G Sbjct: 5 DYYDLLGVSKSATPEEIKKAYRKMALKYHPDKN--PGNKEAEEKFKELSEAYDVLIDQDKRAAYDKYG 70
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DNAJ_DICNV (Chaperone protein dnaJ OS=Dichelobacter nodosus (strain VCS1703A) GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 7.749e-11 Identity = 33/70 (47.14%), Postives = 47/70 (67.14%), Query Frame = 3 Query: 522 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPDK--NKAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSD 725 KD Y ILGV R+ ++++K+YRKLS+K HPD+ N AEE FK ++KA++ LS+ + R YD G D Sbjct: 4 KDLYAILGVCRTANQDEIKKAYRKLSMKWHPDRNPNNKEEAEEKFKEINKAYEILSDSQKRASYDRFGFD 73
BLAST of FC910033 vs. ExPASy Swiss-Prot
Match: DNAJ_CLOK5 (Chaperone protein dnaJ OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 7.749e-11 Identity = 29/70 (41.43%), Postives = 52/70 (74.29%), Query Frame = 3 Query: 522 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKN-KAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSDE 728 KD+YEILG+++ + +D++K++RKL+LK HPD+N AEE FK +++A+Q L++ + + +YD G+ + Sbjct: 4 KDYYEILGLDKGASDQDIKKAFRKLALKYHPDRNPNDKKAEEKFKEINEAYQVLTDPQKKAQYDQFGTTD 73 The following BLAST results are available for this feature:
BLAST of FC910033 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 287
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC910033 ID=FC910033; Name=FC910033; organism=Citrus clementina; type=EST; length=782bpback to top |