FC919304

Overview
NameFC919304
Unique NameFC919304
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length607
Libraries
Library NameType
PCRcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC919304_ssr438 microsatellite FC919304_ssr438:438..449. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig2562 contig Ccv1_Contig2562:245..854. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLT2B_ORYSJ (Non-specific lipid-transfer protein 2B OS=Oryza sativa subsp. japonica GN=LTP2-B PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.751e-24
Identity = 52/92 (56.52%), Postives = 65/92 (70.65%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            AI+CGQV ++++PC+ + R GG  P   CCSGVRSLN AA TT DR+ ACNCLK   G+I G+    AA +P +CG+ IPY ISPS DCS V
Sbjct:   26 AISCGQVNSAVSPCLSYAR-GGSGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSV 116          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLT2A_ORYSJ (Non-specific lipid-transfer protein 2A OS=Oryza sativa subsp. japonica GN=LTP2-A PE=3 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 1.751e-24
Identity = 52/92 (56.52%), Postives = 65/92 (70.65%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            AI+CGQV ++++PC+ + R GG  P   CCSGVRSLN AA TT DR+ ACNCLK   G+I G+    AA +P +CG+ IPY ISPS DCS V
Sbjct:   27 AISCGQVNSAVSPCLSYAR-GGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSV 117          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_PHAAU (Non-specific lipid-transfer protein 1 OS=Phaseolus aureus PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 2.986e-24
Identity = 50/91 (54.95%), Postives = 67/91 (73.63%), Query Frame = 1
Query:  115 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            +TCGQV  +LA CI FL+ GG   PP CC+GV+++  ++RTT DR+A C+CLK A G +RGI PN A  LP +CG+ IPYKIS ST+C+ +
Sbjct:    1 MTCGQVQGNLAQCIGFLQKGG-VVPPSCCTGVKNILNSSRTTADRRAVCSCLKAAAGAVRGINPNNAEALPGKCGVNIPYKISTSTNCNSI 90          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP3_ARATH (Non-specific lipid-transfer protein 3 OS=Arabidopsis thaliana GN=LTP3 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 3.900e-24
Identity = 49/96 (51.04%), Postives = 68/96 (70.83%), Query Frame = 1
Query:  103 VTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            V  AI+CG V  SLAPC  +L  GG   PP CC+GV++LN  A+TTPDRQ AC C++    +I G+ P++A+GLP +CG+ IPY IS ST+C+ ++
Sbjct:   21 VDAAISCGTVAGSLAPCATYLSKGG-LVPPSCCAGVKTLNSMAKTTPDRQQACRCIQSTAKSISGLNPSLASGLPGKCGVSIPYPISMSTNCNNIK 115          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP2_SOLPN (Non-specific lipid-transfer protein 2 OS=Solanum pennellii GN=LTP2 PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 3.900e-24
Identity = 53/97 (54.64%), Postives = 65/97 (67.01%), Query Frame = 1
Query:  100 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            P   A+TCGQVT++LAPC+P+L   G  P   CC GV+ L G A+TT DRQ AC CLK A  +  G+    AA LP  C + IPYKISPSTDCS+V+
Sbjct:   20 PHAEALTCGQVTSTLAPCLPYLMNRG--PLGGCCGGVKGLLGQAQTTVDRQTACTCLKSAASSFTGLDLGKAASLPSTCSVNIPYKISPSTDCSKVQ 114          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLT41_HORVU (Non-specific lipid-transfer protein 4.1 OS=Hordeum vulgare GN=LTP4.1 PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.135e-23
Identity = 49/93 (52.69%), Postives = 66/93 (70.97%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            AI+CGQV+++L+PCI + R  G  PP  CCSGV+ L GAA++T D+QAAC C+K A G   G+    AAG+P  CG+ +PY IS S DCS++R
Sbjct:   26 AISCGQVSSALSPCISYARGNGAKPPAACCSGVKRLAGAAQSTADKQAACKCIKSAAG---GLNAGKAAGIPSMCGVSVPYAISASVDCSKIR 115          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: SCA_LILLO (Stigma/stylar cysteine-rich adhesin OS=Lilium longiflorum GN=SCA PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.482e-23
Identity = 49/94 (52.13%), Postives = 63/94 (67.02%), Query Frame = 1
Query:  109 NAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            +AITCGQV + L  C+ + R GG  PP  CC+GVR+LN  A+TTPDRQ ACNCLK       G+   + AG+P +CG+ IPY I   TDC++VR
Sbjct:   21 SAITCGQVDSDLTSCLGYARKGGVIPPG-CCAGVRTLNNLAKTTPDRQTACNCLKSLVNPSLGLNAAIVAGIPGKCGVNIPYPIRMQTDCNKVR 113          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP2_SOLCI (Non-specific lipid-transfer protein 2 OS=Solanum chilense PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.482e-23
Identity = 53/97 (54.64%), Postives = 65/97 (67.01%), Query Frame = 1
Query:  100 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            P   A+TCGQVT++LAPC+P+L   G  P   CC GV+ L G A+TT DRQAAC CLK A  +   +    AA LP  C + IPYKISPSTDCS+V+
Sbjct:   20 PHAEALTCGQVTSTLAPCLPYLMNRG--PLGGCCGGVKGLLGQAQTTVDRQAACACLKSAASSFTDLDLGKAASLPSTCNVNIPYKISPSTDCSKVQ 114          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLT43_HORVU (Non-specific lipid-transfer protein 4.3 OS=Hordeum vulgare GN=LTP4.3 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.482e-23
Identity = 49/93 (52.69%), Postives = 66/93 (70.97%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            AI+CGQV+++L+PCI + R  G  PP  CCSGV+ L GAA++T D+QAAC C+K A G   G+    AAG+P  CG+ +PY IS S DCS++R
Sbjct:   26 AISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAAG---GLNAGKAAGIPSMCGVSVPYAISASVDCSKIR 115          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLT42_HORVU (Non-specific lipid-transfer protein 4.2 OS=Hordeum vulgare GN=LTP4.2 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.482e-23
Identity = 49/93 (52.69%), Postives = 66/93 (70.97%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            AI+CGQV+++L+PCI + R  G  PP  CCSGV+ L GAA++T D+QAAC C+K A G   G+    AAG+P  CG+ +PY IS S DCS++R
Sbjct:   26 AISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAAG---GLNAGKAAGIPSMCGVSVPYAISASVDCSKIR 115          
The following BLAST results are available for this feature:
BLAST of FC919304 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
NLT2B_ORYSJ1.751e-2456.52Non-specific lipid-transfer protein 2B OS=Oryza sa... [more]
NLT2A_ORYSJ1.751e-2456.52Non-specific lipid-transfer protein 2A OS=Oryza sa... [more]
NLTP1_PHAAU2.986e-2454.95Non-specific lipid-transfer protein 1 OS=Phaseolus... [more]
NLTP3_ARATH3.900e-2451.04Non-specific lipid-transfer protein 3 OS=Arabidops... [more]
NLTP2_SOLPN3.900e-2454.64Non-specific lipid-transfer protein 2 OS=Solanum p... [more]
NLT41_HORVU1.135e-2352.69Non-specific lipid-transfer protein 4.1 OS=Hordeum... [more]
SCA_LILLO1.482e-2352.13Stigma/stylar cysteine-rich adhesin OS=Lilium long... [more]
NLTP2_SOLCI1.482e-2354.64Non-specific lipid-transfer protein 2 OS=Solanum c... [more]
NLT43_HORVU1.482e-2352.69Non-specific lipid-transfer protein 4.3 OS=Hordeum... [more]
NLT42_HORVU1.482e-2352.69Non-specific lipid-transfer protein 4.2 OS=Hordeum... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC06055A06T7 PCR Citrus clementina cDNA clone C06055A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC919304 ID=FC919304|Name=FC919304|organism=Citrus clementina|type=EST|length=607bp
TGATAACTAGCTATAACCAAGCAAAAGCCTCCCTGAAGAATCCTCATGGC
TGCTCTTAAGCTTGTTTGTGCTTTGCTTTTGTGCATTCTGGTGACTGCCC
CGGTGACTAATGCCATAACATGCGGGCAGGTGACAGCCTCCTTGGCTCCA
TGCATCCCTTTCTTGAGAACTGGAGGGCGTTTTCCTCCACCGCCATGCTG
TAGCGGCGTCAGGTCTCTCAACGGCGCCGCCAGAACCACCCCTGACCGCC
AAGCTGCATGCAACTGCTTGAAACGAGCTTACGGAACAATCCGCGGCATC
AAACCTAATGTTGCCGCTGGCCTTCCTANTCAATGTGGAATCAGAATTCC
TTACAAGATCAGCCCCAGCACCGACTGCTCTAGGGTCAGGTGAAGTTGAG
TTTGAGCTCTGTGACTTTCCAAGTATGATTGACTGAGAATAAATAAATAA
AGAATATCTATGTTAATTTCTTTGTCCGAACGAGTCTCCACTTGTATGAG
TTTCACTCTCATGTCATGTTTGTATATTTGCTTTTTATGTCATATTAAAT
ATGTAAACGCGATCTGTGTTTTGAGTGATTAATTATAGTTATTTTGTGGT
ATTATCT
back to top