FC919304

Overview
NameFC919304
Unique NameFC919304
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length607
Libraries
Library NameType
PCRcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC919304_ssr438 microsatellite FC919304_ssr438:438..449. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig2562 contig Ccv1_Contig2562:245..854. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTPD_BRAOT (Non-specific lipid-transfer protein D OS=Brassica oleracea var. italica GN=WAX9D PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 4.036e-21
Identity = 50/99 (50.51%), Postives = 63/99 (63.64%), Query Frame = 1
Query:  100 PVTN--AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            P+T+  A++CG V+  +APCI +L       P  CCSGV SLN  ARTTPDRQ AC CL  A   +  I    AAGLP  CG+ IPYKIS +T+C+ V+
Sbjct:   20 PITSNAALSCGTVSGYVAPCIGYLAQNAPAVPTACCSGVTSLNNMARTTPDRQQACRCLVGAANALPTINVARAAGLPKACGVNIPYKISKTTNCNSVK 118          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP6_GOSHI (Non-specific lipid-transfer protein 6 OS=Gossypium hirsutum GN=LTP6 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.534e-20
Identity = 50/94 (53.19%), Postives = 59/94 (62.77%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPP-CCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            AI+  QV +SL PC+ ++R     P PP  C G+RSL  AAR   DRQAAC C+K     I  I   VAAGLP QC + IPYKISPS DC RV+
Sbjct:   27 AISYDQVKSSLLPCVGYVRGNNARPAPPNYCKGIRSLKSAARIRLDRQAACKCIKSLAADISDINYGVAAGLPGQCNVHIPYKISPSIDCKRVK 120          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP3_VITSX (Non-specific lipid-transfer protein P3 OS=Vitis sp. PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 1.534e-20
Identity = 46/91 (50.55%), Postives = 61/91 (67.03%), Query Frame = 1
Query:  115 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            ++CG V   +A CI +LR  G  P   CC+GV++L  +A TT DR+ AC CL  A  TI G+   +AAGLP +CG+ IPYKISPST+C +V
Sbjct:    1 LSCGDVATQMASCINYLRGAGPLPAA-CCNGVKNLKNSATTTQDRRTACKCLISASKTISGVNFGLAAGLPAKCGVSIPYKISPSTNCDQV 90          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP2_BRANA (Non-specific lipid-transfer protein 2 OS=Brassica napus GN=LTP2 PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.003e-20
Identity = 50/99 (50.51%), Postives = 64/99 (64.65%), Query Frame = 1
Query:  100 PVTN--AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            P+T+  A++CG V+  +APCI +L   G  P   CC+GV +LN  ARTTPDRQ AC CL  A  +   +    AAGLP  CG+ IPYKIS ST+C+ VR
Sbjct:   20 PITSNAALSCGTVSGYVAPCIGYLTQNGPLPRG-CCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTNCNSVR 117          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP3_BRANA (Non-specific lipid-transfer protein 3 OS=Brassica napus GN=LTP3 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.417e-20
Identity = 49/93 (52.69%), Postives = 60/93 (64.52%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            A++CG V+ +LA CI +L   G  P   CCSGV SLN  ARTTPDRQ AC CL  A   +  I    AAGLP  CG+ IPYKIS +T+C+ V+
Sbjct:   26 ALSCGTVSGNLAACIGYLTQNGPVPTA-CCSGVTSLNNMARTTPDRQQACRCLVGAANALPTINVARAAGLPKACGVNIPYKISKTTNCNSVK 117          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP8_HORVU (Non-specific lipid-transfer protein Cw18 OS=Hordeum vulgare GN=CW18 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 5.828e-20
Identity = 44/92 (47.83%), Postives = 59/92 (64.13%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            AITCGQV+++L PC  + +  G  P   CCSGV+ L G AR+T D+QA C CLK   G     +   AAG+P +CG+ +PY IS S DCS++
Sbjct:   26 AITCGQVSSALGPCAAYAKGSGTSPSAGCCSGVKRLAGLARSTADKQATCRCLKSVAGAYNAGR---AAGIPSRCGVSVPYTISASVDCSKI 114          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTPB_BRAOT (Non-specific lipid-transfer protein B OS=Brassica oleracea var. italica GN=WAX9B PE=3 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 7.612e-20
Identity = 48/93 (51.61%), Postives = 60/93 (64.52%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            A++CG V+ +LA CI +L   G  P   CC+GV +LN  ARTTPDRQ AC CL  A  +   +    AAGLP  CG+ IPYKIS ST+C+ VR
Sbjct:   26 ALSCGTVSGNLAACIGYLTQNGPLPRG-CCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTNCNSVR 117          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTPA_BRAOT (Non-specific lipid-transfer protein A OS=Brassica oleracea var. italica GN=WAX9A PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 9.941e-20
Identity = 48/103 (46.60%), Postives = 67/103 (65.05%), Query Frame = 1
Query:  100 PVT--NAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNV----AAGLPXQCGIRIPYKISPSTDCSRVR 390
            P+T   A+TCG V +++APCI ++  GG  P   CC+GV  LN  ARTTPDRQ AC CL+ A    R + PN+    AAG+P  CG+ +P+ IS +T+C+ V+
Sbjct:   20 PITANRALTCGTVNSNVAPCIGYITQGGTLPGA-CCTGVSKLNSMARTTPDRQQACRCLETA---ARALGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNVK 118          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_BRANA (Non-specific lipid-transfer protein 1 OS=Brassica napus GN=LTP1 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 9.941e-20
Identity = 48/93 (51.61%), Postives = 59/93 (63.44%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            A++CG V+ +LA CI +L   G  P   CC+GV +LN  ARTTPDRQ AC CL  A      +    AAGLP  CG+ IPYKIS ST+C+ VR
Sbjct:   26 ALSCGTVSGNLAACIGYLTQNGPLPRG-CCTGVTNLNNMARTTPDRQQACRCLVGAANAFPTLNAARAAGLPKACGVNIPYKISKSTNCNSVR 117          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP_AMACA (Non-specific lipid-transfer protein OS=Amaranthus caudatus PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.298e-19
Identity = 44/94 (46.81%), Postives = 62/94 (65.96%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPP-CCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            A+TC  VT +L PC+ +L+  G  PPP  CC+GVRSL  AA+T  DR+ ACNC+K A    + +   VAA L  QCG+R+ Y +SP+ +C+ V+
Sbjct:    1 AVTCTVVTKALGPCMTYLKGTGATPPPANCCAGVRSLKAAAQTVADRRMACNCMKSAAQKTKSLNYKVAARLASQCGVRMSYSVSPNVNCNSVQ 94          
The following BLAST results are available for this feature:
BLAST of FC919304 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
NLTPD_BRAOT4.036e-2150.51Non-specific lipid-transfer protein D OS=Brassica ... [more]
NLTP6_GOSHI1.534e-2053.19Non-specific lipid-transfer protein 6 OS=Gossypium... [more]
NLTP3_VITSX1.534e-2050.55Non-specific lipid-transfer protein P3 OS=Vitis sp... [more]
NLTP2_BRANA2.003e-2050.51Non-specific lipid-transfer protein 2 OS=Brassica ... [more]
NLTP3_BRANA3.417e-2052.69Non-specific lipid-transfer protein 3 OS=Brassica ... [more]
NLTP8_HORVU5.828e-2047.83Non-specific lipid-transfer protein Cw18 OS=Hordeu... [more]
NLTPB_BRAOT7.612e-2051.61Non-specific lipid-transfer protein B OS=Brassica ... [more]
NLTPA_BRAOT9.941e-2046.60Non-specific lipid-transfer protein A OS=Brassica ... [more]
NLTP1_BRANA9.941e-2051.61Non-specific lipid-transfer protein 1 OS=Brassica ... [more]
NLTP_AMACA1.298e-1946.81Non-specific lipid-transfer protein OS=Amaranthus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC06055A06T7 PCR Citrus clementina cDNA clone C06055A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC919304 ID=FC919304|Name=FC919304|organism=Citrus clementina|type=EST|length=607bp
TGATAACTAGCTATAACCAAGCAAAAGCCTCCCTGAAGAATCCTCATGGC
TGCTCTTAAGCTTGTTTGTGCTTTGCTTTTGTGCATTCTGGTGACTGCCC
CGGTGACTAATGCCATAACATGCGGGCAGGTGACAGCCTCCTTGGCTCCA
TGCATCCCTTTCTTGAGAACTGGAGGGCGTTTTCCTCCACCGCCATGCTG
TAGCGGCGTCAGGTCTCTCAACGGCGCCGCCAGAACCACCCCTGACCGCC
AAGCTGCATGCAACTGCTTGAAACGAGCTTACGGAACAATCCGCGGCATC
AAACCTAATGTTGCCGCTGGCCTTCCTANTCAATGTGGAATCAGAATTCC
TTACAAGATCAGCCCCAGCACCGACTGCTCTAGGGTCAGGTGAAGTTGAG
TTTGAGCTCTGTGACTTTCCAAGTATGATTGACTGAGAATAAATAAATAA
AGAATATCTATGTTAATTTCTTTGTCCGAACGAGTCTCCACTTGTATGAG
TTTCACTCTCATGTCATGTTTGTATATTTGCTTTTTATGTCATATTAAAT
ATGTAAACGCGATCTGTGTTTTGAGTGATTAATTATAGTTATTTTGTGGT
ATTATCT
back to top