FC919304

Overview
NameFC919304
Unique NameFC919304
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length607
Libraries
Library NameType
PCRcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC919304_ssr438 microsatellite FC919304_ssr438:438..449. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig2562 contig Ccv1_Contig2562:245..854. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_AMAHP (Non-specific lipid-transfer protein 1 OS=Amaranthus hypochondriacus PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.298e-19
Identity = 44/94 (46.81%), Postives = 62/94 (65.96%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPP-CCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            A+TC  VT +L PC+ +L+  G  PPP  CC+GVRSL  AA+T  DR+ ACNC+K A    + +   VAA L  QCG+R+ Y +SP+ +C+ V+
Sbjct:    1 AVTCTVVTKALGPCMTYLKGTGATPPPANCCAGVRSLKAAAQTVADRRMACNCMKSAAQKTKSLNYKVAARLASQCGVRMSYSVSPNVNCNSVQ 94          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP3_ORYSJ (Non-specific lipid-transfer protein 3 OS=Oryza sativa subsp. japonica GN=LTP110-A PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 6.444e-19
Identity = 39/92 (42.39%), Postives = 60/92 (65.22%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            A++CG VT+S+APC+ ++      P   CCSGVR+LNG A ++ DR+ AC+CLK    + R +    AA +P +CG+ + + IS S DCS++
Sbjct:   29 AVSCGDVTSSIAPCLSYVMGRESSPSSSCCSGVRTLNGKASSSADRRTACSCLKNMASSFRNLNMGNAASIPSKCGVSVAFPISTSVDCSKI 120          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP3_ORYSI (Non-specific lipid-transfer protein 3 OS=Oryza sativa subsp. indica GN=LTP110-A PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 6.444e-19
Identity = 39/92 (42.39%), Postives = 60/92 (65.22%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            A++CG VT+S+APC+ ++      P   CCSGVR+LNG A ++ DR+ AC+CLK    + R +    AA +P +CG+ + + IS S DCS++
Sbjct:   29 AVSCGDVTSSIAPCLSYVMGRESSPSSSCCSGVRTLNGKASSSADRRTACSCLKNMASSFRNLNMGNAASIPSKCGVSVAFPISTSVDCSKI 120          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_HELAN (Non-specific lipid-transfer protein AP10 OS=Helianthus annuus PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 6.444e-19
Identity = 41/92 (44.57%), Postives = 62/92 (67.39%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            AITC  VT +L PC+P+LR+GG+ P P CC+G + L GA RT  DR+ AC C K A   ++ ++P++A+ LP +CGI     I+P+ +C+ +
Sbjct:   26 AITCNDVTGNLTPCLPYLRSGGK-PTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCGISTSIPINPNVNCNTI 115          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTPC_ARATH (Non-specific lipid-transfer protein 12 OS=Arabidopsis thaliana GN=LTP12 PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.436e-18
Identity = 44/96 (45.83%), Postives = 59/96 (61.46%), Query Frame = 1
Query:  100 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            P  + I CG VT++LA C+ +L   G  P   CC GV+SL   A+TTPDR+  C CLK A   I+G+  ++ A LP  CG+ IPY IS ST+C  +
Sbjct:   21 PTESTIQCGTVTSTLAQCLTYLTNSGPLPSQ-CCVGVKSLYQLAQTTPDRKQVCECLKLAGKEIKGLNTDLVAALPTTCGVSIPYPISFSTNCDSI 115          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_HORVU (Non-specific lipid-transfer protein 1 OS=Hordeum vulgare GN=LTP1 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.198e-18
Identity = 40/92 (43.48%), Postives = 58/92 (63.04%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            A+ CGQV + + PC+ +++ GG  P   CC+GVR L+  A+++ DRQ  CNCLK     I  +  N AA +P +C + +PY ISP  DCSR+
Sbjct:   26 ALNCGQVDSKMKPCLTYVQ-GGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI 116          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTPB_ARATH (Non-specific lipid-transfer protein 11 OS=Arabidopsis thaliana GN=LTP11 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.215e-17
Identity = 43/92 (46.74%), Postives = 54/92 (58.70%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            AI C QV   LA C+P+L+ GG  P P CC+G+ SL  AA    DRQ ACNCLK    TI GI  + A  LP +CG+ I    S + DC+ +
Sbjct:   28 AIACPQVNMYLAQCLPYLKAGGN-PSPMCCNGLNSLKAAAPEKADRQVACNCLKSVANTIPGINDDFAKQLPAKCGVNIGVPFSKTVDCNSI 118          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTPA_RICCO (Non-specific lipid-transfer protein A OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.031e-17
Identity = 41/91 (45.05%), Postives = 56/91 (61.54%), Query Frame = 1
Query:  115 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            + CGQV +SLA CIPFL  G   P   CC+GV++L   A T+ DR+AAC C+K A      IK + A+ LP +CG+ I   IS +T+C  +
Sbjct:    1 VDCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKTLAPTSADRRAACECIKAAAARFPTIKQDAASSLPKKCGVDINIPISKTTNCQAI 91          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_WHEAT (Non-specific lipid-transfer protein (Fragment) OS=Triticum aestivum PE=1 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 1.029e-16
Identity = 40/92 (43.48%), Postives = 58/92 (63.04%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            AI CG V + + PC+ +++ GG  P   CC GV++L+  AR+  DRQ+ACNCLK     I  +  + A  +P +CG+ +PY IS + DCSRV
Sbjct:   23 AIDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV 113          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP7_ARATH (Non-specific lipid-transfer protein 7 OS=Arabidopsis thaliana GN=LTP7 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.344e-16
Identity = 43/94 (45.74%), Postives = 61/94 (64.89%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGG-RFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTI-RGIKPNVAAGLPXQCGIRIPY--KISPSTDCS 381
            A++CG+V ++L PC  +L  GG   P P CC+GVR LNG   TT DR+ AC C+K A   +  G+  + AAG+P +CGI+IPY  +I  +T C+
Sbjct:   26 ALSCGEVNSNLKPCTGYLTNGGITSPGPQCCNGVRKLNGMVLTTLDRRQACRCIKNAARNVGPGLNADRAAGIPRRCGIKIPYSTQIRFNTKCN 119          
The following BLAST results are available for this feature:
BLAST of FC919304 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
NLTP1_AMAHP1.298e-1946.81Non-specific lipid-transfer protein 1 OS=Amaranthu... [more]
NLTP3_ORYSJ6.444e-1942.39Non-specific lipid-transfer protein 3 OS=Oryza sat... [more]
NLTP3_ORYSI6.444e-1942.39Non-specific lipid-transfer protein 3 OS=Oryza sat... [more]
NLTP1_HELAN6.444e-1944.57Non-specific lipid-transfer protein AP10 OS=Helian... [more]
NLTPC_ARATH1.436e-1845.83Non-specific lipid-transfer protein 12 OS=Arabidop... [more]
NLTP1_HORVU3.198e-1843.48Non-specific lipid-transfer protein 1 OS=Hordeum v... [more]
NLTPB_ARATH1.215e-1746.74Non-specific lipid-transfer protein 11 OS=Arabidop... [more]
NLTPA_RICCO6.031e-1745.05Non-specific lipid-transfer protein A OS=Ricinus c... [more]
NLTP1_WHEAT1.029e-1643.48Non-specific lipid-transfer protein (Fragment) OS=... [more]
NLTP7_ARATH1.344e-1645.74Non-specific lipid-transfer protein 7 OS=Arabidops... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC06055A06T7 PCR Citrus clementina cDNA clone C06055A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC919304 ID=FC919304|Name=FC919304|organism=Citrus clementina|type=EST|length=607bp
TGATAACTAGCTATAACCAAGCAAAAGCCTCCCTGAAGAATCCTCATGGC
TGCTCTTAAGCTTGTTTGTGCTTTGCTTTTGTGCATTCTGGTGACTGCCC
CGGTGACTAATGCCATAACATGCGGGCAGGTGACAGCCTCCTTGGCTCCA
TGCATCCCTTTCTTGAGAACTGGAGGGCGTTTTCCTCCACCGCCATGCTG
TAGCGGCGTCAGGTCTCTCAACGGCGCCGCCAGAACCACCCCTGACCGCC
AAGCTGCATGCAACTGCTTGAAACGAGCTTACGGAACAATCCGCGGCATC
AAACCTAATGTTGCCGCTGGCCTTCCTANTCAATGTGGAATCAGAATTCC
TTACAAGATCAGCCCCAGCACCGACTGCTCTAGGGTCAGGTGAAGTTGAG
TTTGAGCTCTGTGACTTTCCAAGTATGATTGACTGAGAATAAATAAATAA
AGAATATCTATGTTAATTTCTTTGTCCGAACGAGTCTCCACTTGTATGAG
TTTCACTCTCATGTCATGTTTGTATATTTGCTTTTTATGTCATATTAAAT
ATGTAAACGCGATCTGTGTTTTGAGTGATTAATTATAGTTATTTTGTGGT
ATTATCT
back to top