FC919304

Overview
NameFC919304
Unique NameFC919304
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length607
Libraries
Library NameType
PCRcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC919304_ssr438 microsatellite FC919304_ssr438:438..449. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig2562 contig Ccv1_Contig2562:245..854. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP2_ARATH (Non-specific lipid-transfer protein 2 OS=Arabidopsis thaliana GN=LTP2 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.993e-16
Identity = 48/100 (48.00%), Postives = 61/100 (61.00%), Query Frame = 1
Query:  100 PVT-NAI-TCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIR-GIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            P+T NA+ +CG V  +LA CI +L  G       CC+GV +L   A TTPDRQ AC CL+ A   +  G+    AAGLP  C + IPYKIS ST+C+ VR
Sbjct:   20 PITANALMSCGTVNGNLAGCIAYLTRGAPLTQG-CCNGVTNLKNMASTTPDRQQACRCLQSAAKAVGPGLNTARAAGLPSACKVNIPYKISASTNCNTVR 118          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP5_ARATH (Non-specific lipid-transfer protein 5 OS=Arabidopsis thaliana GN=LTP5 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 5.106e-16
Identity = 48/96 (50.00%), Postives = 58/96 (60.42%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLK---RAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            AI+CG VT SL  C  +L  GG F P  CCSGV+ LN  ARTT DRQ AC C++   RA G+   +    AA LP  C +RI Y IS  T+C+ VR
Sbjct:   26 AISCGAVTGSLGQCYNYLTRGG-FIPRGCCSGVQRLNSLARTTRDRQQACRCIQGAARALGS--RLNAGRAARLPGACRVRISYPISARTNCNTVR 118          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTPA_ARATH (Non-specific lipid-transfer protein 10 OS=Arabidopsis thaliana GN=LTP10 PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.709e-16
Identity = 38/95 (40.00%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIR--GIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            AI+C  V A+L PC+ ++  GG  P   CC+G+R L+  A +  D+Q  C C+K   G +    I    AA LP +CG+++PYKI PST+C+ ++
Sbjct:   23 AISCNAVQANLYPCVVYVVQGGAIPYS-CCNGIRMLSKQATSASDKQGVCRCIKSVVGRVSYSSIYLKKAAALPGKCGVKLPYKIDPSTNCNSIK 116          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP8_ARATH (Non-specific lipid-transfer protein 8 OS=Arabidopsis thaliana GN=LTP8 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.709e-16
Identity = 37/93 (39.78%), Postives = 54/93 (58.06%), Query Frame = 1
Query:  109 NAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            +AI+C  V   L PC+ +L +G   PP  CC GV+SL  A  T+ D++AAC C+K    ++  +KP +A  L   CG  +P   SP+ DC+ V
Sbjct:   24 SAISCSVVLQDLQPCVSYLTSGSGNPPETCCDGVKSLAAATTTSADKKAACQCIKSVANSVT-VKPELAQALASNCGASLPVDASPTVDCTTV 115          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP6_ARATH (Non-specific lipid-transfer protein 6 OS=Arabidopsis thaliana GN=LTP6 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.309e-15
Identity = 39/96 (40.62%), Postives = 57/96 (59.38%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNV---AAGLPXQCGIRIPYKISPSTDCSRVR 390
            A++C  V A L PC+ ++  GG  P   CC+G+ +L   A+T+ DRQ  C C+K A G +  + P     A  LP +CG+ +PYK SPSTDC  ++
Sbjct:   20 AVSCNTVIADLYPCLSYVTQGGPVPTL-CCNGLTTLKSQAQTSVDRQGVCRCIKSAIGGLT-LSPRTIQNALELPSKCGVDLPYKFSPSTDCDSIQ 113          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP_PINTA (Non-specific lipid-transfer protein OS=Pinus taeda PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 7.373e-15
Identity = 40/97 (41.24%), Postives = 53/97 (54.64%), Query Frame = 1
Query:  100 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIR-IPYKISPSTDCSRV 387
            PV  AI+C QV +++ PC  +L      P   CC  +R L+   + TPDRQA CNCLK       G+K   AA LP  C +  +   ISP+ DCS+V
Sbjct:   27 PVEGAISCNQVVSAMTPCATYLIGNAATPAATCCPSIRGLDSQVKATPDRQAVCNCLK-TQAKSYGVKLGKAANLPGLCKVTDLNVPISPNVDCSKV 122          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTPB_RICCO (Non-specific lipid-transfer protein B OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.046e-13
Identity = 34/91 (37.36%), Postives = 50/91 (54.95%), Query Frame = 1
Query:  115 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            + CGQV  +L+ C+PFL      P   CC+GV  L   A T  D++ AC C+K A      I+ + A+ LP +CG+ I   IS +T+C  +
Sbjct:    1 VNCGQVNKALSSCVPFLTGFDTTPSLTCCAGVMELKRLAPTVKDKRIACECVKTAAARYPNIREDAASSLPYKCGVVINVPISKTTNCHEI 91          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLT21_PARJU (Probable non-specific lipid-transfer protein 2 OS=Parietaria judaica PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.899e-11
Identity = 32/98 (32.65%), Postives = 52/98 (53.06%), Query Frame = 1
Query:  100 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPY-KISPSTDCSRVR 390
            P      CG+V   + PC+ F++   + P   CCSG + L+   +TT  ++ AC C+ RA   I GIK  + A +P +C I+     I+   DCS+++
Sbjct:   28 PAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQ 125          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLT13_PARJU (Probable non-specific lipid-transfer protein 1 OS=Parietaria judaica PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.945e-11
Identity = 33/90 (36.67%), Postives = 49/90 (54.44%), Query Frame = 1
Query:  118 TCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISP---STDC 378
            TCG V  +L PC+PF++   + P   CCSG + L+G  +T P R  AC C++ A  T   I   + + +P  CGI +  K+ P   + DC
Sbjct:   39 TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDC 127          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLT11_PARJU (Probable non-specific lipid-transfer protein (Fragment) OS=Parietaria judaica GN=PMAI PE=1 SV=3)

HSP 1 Score: 67.3958 bits (163), Expect = 6.459e-11
Identity = 33/93 (35.48%), Postives = 50/93 (53.76%), Query Frame = 1
Query:  118 TCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISP---STDCSRV 387
            TCG +  +L PC+PF++   + P   CCSG + L+G  +T P R  AC C++ A  T   I   + + +P  CGI +  K+ P   + DC  V
Sbjct:    3 TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 94          
The following BLAST results are available for this feature:
BLAST of FC919304 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
NLTP2_ARATH2.993e-1648.00Non-specific lipid-transfer protein 2 OS=Arabidops... [more]
NLTP5_ARATH5.106e-1650.00Non-specific lipid-transfer protein 5 OS=Arabidops... [more]
NLTPA_ARATH8.709e-1640.00Non-specific lipid-transfer protein 10 OS=Arabidop... [more]
NLTP8_ARATH8.709e-1639.78Non-specific lipid-transfer protein 8 OS=Arabidops... [more]
NLTP6_ARATH3.309e-1540.63Non-specific lipid-transfer protein 6 OS=Arabidops... [more]
NLTP_PINTA7.373e-1541.24Non-specific lipid-transfer protein OS=Pinus taeda... [more]
NLTPB_RICCO4.046e-1337.36Non-specific lipid-transfer protein B OS=Ricinus c... [more]
NLT21_PARJU2.899e-1132.65Probable non-specific lipid-transfer protein 2 OS=... [more]
NLT13_PARJU4.945e-1136.67Probable non-specific lipid-transfer protein 1 OS=... [more]
NLT11_PARJU6.459e-1135.48Probable non-specific lipid-transfer protein (Frag... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC06055A06T7 PCR Citrus clementina cDNA clone C06055A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC919304 ID=FC919304|Name=FC919304|organism=Citrus clementina|type=EST|length=607bp
TGATAACTAGCTATAACCAAGCAAAAGCCTCCCTGAAGAATCCTCATGGC
TGCTCTTAAGCTTGTTTGTGCTTTGCTTTTGTGCATTCTGGTGACTGCCC
CGGTGACTAATGCCATAACATGCGGGCAGGTGACAGCCTCCTTGGCTCCA
TGCATCCCTTTCTTGAGAACTGGAGGGCGTTTTCCTCCACCGCCATGCTG
TAGCGGCGTCAGGTCTCTCAACGGCGCCGCCAGAACCACCCCTGACCGCC
AAGCTGCATGCAACTGCTTGAAACGAGCTTACGGAACAATCCGCGGCATC
AAACCTAATGTTGCCGCTGGCCTTCCTANTCAATGTGGAATCAGAATTCC
TTACAAGATCAGCCCCAGCACCGACTGCTCTAGGGTCAGGTGAAGTTGAG
TTTGAGCTCTGTGACTTTCCAAGTATGATTGACTGAGAATAAATAAATAA
AGAATATCTATGTTAATTTCTTTGTCCGAACGAGTCTCCACTTGTATGAG
TTTCACTCTCATGTCATGTTTGTATATTTGCTTTTTATGTCATATTAAAT
ATGTAAACGCGATCTGTGTTTTGAGTGATTAATTATAGTTATTTTGTGGT
ATTATCT
back to top