FC920175

Overview
NameFC920175
Unique NameFC920175
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9238 contig Ccv1_Contig9238:61..748. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_SHIB3 (Glyoxylate/hydroxypyruvate reductase B OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ENTS8 (Glyoxylate/hydroxypyruvate reductase B OS=Enterobacter sakazakii (strain ATCC BAA-894) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 57/190 (30.00%), Postives = 89/190 (46.84%), Query Frame = 3
Query:  117 TLHAHSVKAIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            T+ AH+  + FS A         V A +L  +P +R     S G ++ DV     + +AL +   V +E VAD  + L++   R+       V+ G W   I  ++  G  +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L A SD + +   LTD+THH+I  +
Sbjct:   35 TIEAHA--SAFSEAQGLLGSSEKVDAALLEKMPALRAASTVSVGYDNFDVDALSAKKIALMHTPTVLTETVADTLMTLVLTTARRALEVAERVKAGEWTGSIGPDW-FGCDVHHKTLGIVGMGRIGLALAQRAHFGFNMPILYNARRHHSEAEERFNARYCDLDTLLAESDFVCVILPLTDETHHMIGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ENTAG (Glyoxylate/hydroxypyruvate reductase B OS=Enterobacter agglomerans GN=tkrA PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 49/157 (31.21%), Postives = 79/157 (50.32%), Query Frame = 3
Query:  198 EVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRL-EAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            ++R     S G ++ DV    +RG+ L +   V +E VAD  + L++   R++      V+ G W   I  ++  G  +  K++GI+G+G IG  +A+R    FG  + YN+R         F   Y D+  L   SD L I   LT+QTHH+I ++
Sbjct:   65 KLRAASTISVGYDNFDVEALNQRGIVLIDTPTVLTETVADTMMALVLSSARRVVEVAERVKAGEWRRSIGPDW-FGIDVHHKKMGILGMGRIGLALAQRAHHGFGMPILYNARKHHEEAESRFNAQYCDLDTLLRESDFLCISLPLTEQTHHMIGRE 220          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ENT38 (Glyoxylate/hydroxypyruvate reductase B OS=Enterobacter sp. (strain 638) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 55/185 (29.73%), Postives = 86/185 (46.49%), Query Frame = 3
Query:  126 AHSVKAIFSSAGAPVTAE-----ILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPFYPDVCELAA---NSDVLIICCALTDQTHHLINK 647
            A    A  S+AG   ++E     +L  +P++R     S G ++ DV     R + L +     +E VAD  + L++   R++      V+ G W   I  ++  G  + GK +GIVG+G IG  +A+R    F   + YN+R         F    CEL      +D + +   LTD+THHLI K
Sbjct:   37 AEHADAFASAAGLLGSSEKVDTALLEKMPKLRATSTISVGYDNFDVDALNTRKILLMHTPYALTETVADTLMALVLSTARRVVEVAERVKAGEWTKSIGPDW-FGVDVHGKTLGIVGMGRIGLALAQRAHFGFNMPILYNARRHHSEAEERFEARYCELETLLQEADYVCLILPLTDETHHLIGK 220          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECOUT (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain UTI89 / UPEC) GN=ghrB PE=3 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECOSE (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain SE11) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECOLC (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECOK1 (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O1:K1 / APEC GN=ghrB PE=3 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECO8A (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O8 (strain IAI1) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECO81 (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O81 (strain ED1a) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
The following BLAST results are available for this feature:
BLAST of FC920175 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 100
Match NameE-valueIdentityDescription
GHRB_SHIB32.516e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Shigella... [more]
GHRB_ENTS82.516e-1230.00Glyoxylate/hydroxypyruvate reductase B OS=Enteroba... [more]
GHRB_ENTAG2.516e-1231.21Glyoxylate/hydroxypyruvate reductase B OS=Enteroba... [more]
GHRB_ENT382.516e-1229.73Glyoxylate/hydroxypyruvate reductase B OS=Enteroba... [more]
GHRB_ECOUT2.516e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]
GHRB_ECOSE2.516e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]
GHRB_ECOLC2.516e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]
GHRB_ECOK12.516e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]
GHRB_ECO8A2.516e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]
GHRB_ECO812.516e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A03EF RVDevelop1 Citrus clementina cDNA clone C32005A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920175 ID=FC920175|Name=FC920175|organism=Citrus clementina|type=EST|length=687bp
GGCTACTCTTAAGAAAACCATCAGGCTTCGCTATGTTAGGAGAACAGTTC
TTTACCTCAAACAAATTCCAATACTTGAAAGCATACGAATCAGCGCTTCC
TCTACACGAATTCTTGACACTACACGCGCACTCAGTGAAGGCCATCTTCT
CCAGCGCAGGTGCGCCGGTTACAGCCGAAATCCTCCGCCTGCTTCCAGAG
GTGCGGCTGGTGGTTGCCACAAGCGCCGGCCTTAACCATATTGACGTAGT
AGAGTGCCGCCGCCGCGGTGTGGCTCTGGCCAATGCTGGTAACGTTTTCT
CTGAAGACGTGGCTGATTACGCACTGGGCTTGCTAATTGATGTCCTGAGA
AAACTTTCTGCTGCCGATTGCTTTGTCAGACAAGGGCTTTGGCCTATCAA
CGCTGAATTTCCGCTTGGGTCTAAGTTGGGTGGCAAACGAGTTGGGATTG
TTGGGCTGGGGAGCATTGGGTCTGAAGTTGCCAAAAGGCTTGAAGCTTTC
GGCTGCTGCGTTTCATACAACTCTAGGAATAAAAAGCCTTCTGTTACGTA
CCCTTTCTATCCGGATGTCTGTGAACTTGCAGCTAACAGTGATGTCCTCA
TCATTTGCTGTGCATTGACTGATCAAACACATCACTTGATCAATAAGCAG
TCTTGTTGGCCCTGGGGAAAGAAGGAGTTATTATTAA
back to top