FC920175

Overview
NameFC920175
Unique NameFC920175
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9238 contig Ccv1_Contig9238:61..748. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECO5E (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECO57 (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O157:H7 GN=tkrA PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECO55 (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain 55989 / EAEC) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECO45 (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECO27 (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECO24 (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_CITK8 (Glyoxylate/hydroxypyruvate reductase B OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 49/163 (30.06%), Postives = 80/163 (49.08%), Query Frame = 3
Query:  168 VTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHL 638
            V + +L  +P++R     S G ++ DV     R V L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R   P     F   Y D+  L   +D + +   LT++THHL
Sbjct:   56 VNSALLEKMPKLRAASTVSVGYDNFDVAALNARSVLLMHTPTVLTETVADTVMALVLSTARRVVEVAERVKVGEWTKSIGPDW-FGTDVHHKTLGIVGMGRIGLALAQRAHFGFNMPILYNARRHHPEAEERFNARYCDLDTLLQAADFVCLILPLTEETHHL 217          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_SHIF8 (Glyoxylate/hydroxypyruvate reductase B OS=Shigella flexneri serotype 5b (strain 8401) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.286e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSV---KAIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  ++   +H+   L   +V    AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQAHFTVHQVANLSPQTVVQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECOHS (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O9:H4 (strain HS) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.286e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGGWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECO7I (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ghrB PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.286e-12
Identity = 58/207 (28.02%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+THHL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAVLLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAE 221          
The following BLAST results are available for this feature:
BLAST of FC920175 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 100
Match NameE-valueIdentityDescription
GHRB_ECO5E2.516e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]
GHRB_ECO572.516e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]
GHRB_ECO552.516e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]
GHRB_ECO452.516e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]
GHRB_ECO272.516e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]
GHRB_ECO242.516e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]
GHRB_CITK82.516e-1230.06Glyoxylate/hydroxypyruvate reductase B OS=Citrobac... [more]
GHRB_SHIF83.286e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Shigella... [more]
GHRB_ECOHS3.286e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]
GHRB_ECO7I3.286e-1228.02Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A03EF RVDevelop1 Citrus clementina cDNA clone C32005A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920175 ID=FC920175|Name=FC920175|organism=Citrus clementina|type=EST|length=687bp
GGCTACTCTTAAGAAAACCATCAGGCTTCGCTATGTTAGGAGAACAGTTC
TTTACCTCAAACAAATTCCAATACTTGAAAGCATACGAATCAGCGCTTCC
TCTACACGAATTCTTGACACTACACGCGCACTCAGTGAAGGCCATCTTCT
CCAGCGCAGGTGCGCCGGTTACAGCCGAAATCCTCCGCCTGCTTCCAGAG
GTGCGGCTGGTGGTTGCCACAAGCGCCGGCCTTAACCATATTGACGTAGT
AGAGTGCCGCCGCCGCGGTGTGGCTCTGGCCAATGCTGGTAACGTTTTCT
CTGAAGACGTGGCTGATTACGCACTGGGCTTGCTAATTGATGTCCTGAGA
AAACTTTCTGCTGCCGATTGCTTTGTCAGACAAGGGCTTTGGCCTATCAA
CGCTGAATTTCCGCTTGGGTCTAAGTTGGGTGGCAAACGAGTTGGGATTG
TTGGGCTGGGGAGCATTGGGTCTGAAGTTGCCAAAAGGCTTGAAGCTTTC
GGCTGCTGCGTTTCATACAACTCTAGGAATAAAAAGCCTTCTGTTACGTA
CCCTTTCTATCCGGATGTCTGTGAACTTGCAGCTAACAGTGATGTCCTCA
TCATTTGCTGTGCATTGACTGATCAAACACATCACTTGATCAATAAGCAG
TCTTGTTGGCCCTGGGGAAAGAAGGAGTTATTATTAA
back to top