FC920175

Overview
NameFC920175
Unique NameFC920175
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9238 contig Ccv1_Contig9238:61..748. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: SERA_MOUSE (D-3-phosphoglycerate dehydrogenase OS=Mus musculus GN=Phgdh PE=1 SV=3)

HSP 1 Score: 70.0922 bits (170), Expect = 1.249e-11
Identity = 36/132 (27.27%), Postives = 73/132 (55.30%), Query Frame = 3
Query:  108 EFLTLHAHSVKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFG 503
            E L       + +   +   VTA+++    ++++V     G++++D+    R+G+ + N  N  S   A+   G+++ + R++  A   ++ G W  + +  +G++L GK +GI+GLG IG EVA R+++FG
Sbjct:   39 EELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKW--DRKKFMGTELNGKTLGILGLGRIGREVATRMQSFG 168          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: SERA_HUMAN (D-3-phosphoglycerate dehydrogenase OS=Homo sapiens GN=PHGDH PE=1 SV=4)

HSP 1 Score: 70.0922 bits (170), Expect = 1.249e-11
Identity = 37/132 (28.03%), Postives = 73/132 (55.30%), Query Frame = 3
Query:  108 EFLTLHAHSVKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFG 503
            E L       + +   +   VTA+++    ++++V     G++++D+    R+G+ + N  N  S   A+   G+++ + R++  A   ++ G W    +F +G++L GK +GI+GLG IG EVA R+++FG
Sbjct:   39 EELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWE-RKKF-MGTELNGKTLGILGLGRIGREVATRMQSFG 168          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECOL5 (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ghrB PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.249e-11
Identity = 57/207 (27.54%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V+   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+T+HL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVDAALLEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETYHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: YEAA_SCHPO (Putative 2-hydroxyacid dehydrogenase UNK4.10 OS=Schizosaccharomyces pombe GN=SPACUNK4.10 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.631e-11
Identity = 46/155 (29.68%), Postives = 70/155 (45.16%), Query Frame = 3
Query:  189 LLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKP--SVTYPFYPDVCELAANSDVLIICCALTDQTHHLINK 647
            L P V+ +    AG   +DV  C  RG+ +++      +  AD  + L++  LR  +     + +  W  NA         GK +GI+GLG IG  +AKR  AF   + Y++R   P        +    +L A SDVL +   L   T H+I K
Sbjct:   77 LPPSVKFICHLGAGYETVDVAACTARGIQVSHVPKAVDDATADVGIFLMLGALRGFNQGIFELHKNNW--NANCKPSHDPEGKTLGILGLGGIGKTMAKRARAFDMKIVYHNRTPLPEEEAEGAEFVSFDDLLAKSDVLSLNLPLNAHTRHIIGK 229          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_ECOLU (Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ghrB PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.130e-11
Identity = 56/207 (27.05%), Postives = 95/207 (45.89%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +++   AIF+ A         V A +L  +P++R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+T+HL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTIEQNAAIFAEAEGLLGSNENVDAALLGKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDSLLQESDFVCLILPLTDETYHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: SERA_PIG (D-3-phosphoglycerate dehydrogenase OS=Sus scrofa GN=PHGDH PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.633e-11
Identity = 36/132 (27.27%), Postives = 73/132 (55.30%), Query Frame = 3
Query:  108 EFLTLHAHSVKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFG 503
            E L       + +   +   VT++++    ++++V     G++++D+    R+G+ + N  N  S   A+   G+++ + R++  A   ++ G W    +F +G++L GK +GI+GLG IG EVA R+++FG
Sbjct:   39 EELIAELQDCEGLIVRSATKVTSDVINAAKKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMILCLARQIPQATASMKDGKWE-RKKF-MGTELNGKVLGILGLGRIGREVATRMQSFG 168          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_SHIDS (Glyoxylate/hydroxypyruvate reductase B OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ghrB PE=3 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 3.633e-11
Identity = 57/207 (27.54%), Postives = 93/207 (44.93%), Query Frame = 3
Query:   75 LKAYESALPLHEFLTLHAHSVK---AIFSSA------GAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            L+  +    +H+   L   +V    AIF+ A         V A +L  +P +R     S G ++ DV     R + L +   V +E VAD  + L++   R++      V+ G W   I  ++  G+ +  K +GIVG+G IG  +A+R    F   + YN+R         F   Y D+  L   SD + +   LTD+T+HL   +
Sbjct:   16 LQRLQEHFTVHQVANLSPQTVDQNAAIFAEAEGLLGSNENVDAALLEKMPRLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDW-YGTDVYHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHHKEAEERFNARYCDLDTLLQESDFVCLILPLTDETYHLFGAE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: SERA_BOVIN (D-3-phosphoglycerate dehydrogenase OS=Bos taurus GN=PHGDH PE=2 SV=3)

HSP 1 Score: 68.1662 bits (165), Expect = 4.745e-11
Identity = 37/132 (28.03%), Postives = 73/132 (55.30%), Query Frame = 3
Query:  108 EFLTLHAHSVKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFG 503
            E L       + +   +   VT++I+    ++++V     G++++D+    R+G+ + N  N  S   A+   G+++ + R++  A   ++ G W    +F +G++L GK +GI+GLG IG EVA R+++FG
Sbjct:   39 EELIAELQDCEGLIVRSATKVTSDIINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQAAASMKDGKWE-RKKF-MGTELNGKVLGILGLGRIGREVATRMQSFG 168          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: DDH2_SCHPO (2-hydroxyacid dehydrogenase homolog 2 OS=Schizosaccharomyces pombe GN=SPAC186.02c PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.198e-11
Identity = 51/167 (30.54%), Postives = 83/167 (49.70%), Query Frame = 3
Query:  168 VTAEILRLLPE--VRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCV-SYNSRNKKPSVTYPF-YPDVCELAANSDVLIICCALTDQTHHLINKQS 653
            V A+ L+ L E  V+LV     G N++++       + + +  +     V+++ +GLL+ + RK+  A   VR+     N    LG  + GK VG++G G IGS VAK  +  FGC V +Y+    K    Y   + +  E+   +D L + C LT  T H++N  S
Sbjct:   56 VDADTLKALAENGVKLVALRCGGYNNVNLKAASEYKITVVHVPSYSPFAVSEFTVGLLLSLNRKIHRAYVRVRED--DFNIVGLLGCDIHGKTVGVIGTGKIGSNVAKCFKMGFGCDVLAYDINPDKKLENYGVQFVEQNEVLKKADFLCLHCPLTPSTTHIVNSDS 220          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: CTBP2_XENLA (C-terminal-binding protein 2 OS=Xenopus laevis GN=ctbp2 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.198e-11
Identity = 45/168 (26.79%), Postives = 84/168 (50.00%), Query Frame = 3
Query:  168 VTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPINAE-----FPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCV----SYNSRNKKPSVTYPFYPDVCELAANSDVLIICCALTDQTHHLIN 644
            ++ E L     +R+++   +G ++ID+      G+A+ N  +   E+ AD  L  ++++ R+++     +R+G  P + E         +++ G+ +GI+GLG IG  VA R +AF   V     Y +   + S+       + EL  +SD + + C L +  HHLIN
Sbjct:   84 LSREDLEKFKALRIIIKIGSGYDNIDIKSAAELGIAVCNIPSASVEETADSTLCHILNLYRRVTWLHQAMREGNRPASVEQIREVAGGAARIRGETLGIIGLGRIGQAVALRAKAFNFTVIFYDPYLADGVERSLGLQRMATLQELLMHSDCITLHCNLNEHNHHLIN 251          
The following BLAST results are available for this feature:
BLAST of FC920175 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 100
Match NameE-valueIdentityDescription
SERA_MOUSE1.249e-1127.27D-3-phosphoglycerate dehydrogenase OS=Mus musculus... [more]
SERA_HUMAN1.249e-1128.03D-3-phosphoglycerate dehydrogenase OS=Homo sapiens... [more]
GHRB_ECOL51.249e-1127.54Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]
YEAA_SCHPO1.631e-1129.68Putative 2-hydroxyacid dehydrogenase UNK4.10 OS=Sc... [more]
GHRB_ECOLU2.130e-1127.05Glyoxylate/hydroxypyruvate reductase B OS=Escheric... [more]
SERA_PIG3.633e-1127.27D-3-phosphoglycerate dehydrogenase OS=Sus scrofa G... [more]
GHRB_SHIDS3.633e-1127.54Glyoxylate/hydroxypyruvate reductase B OS=Shigella... [more]
SERA_BOVIN4.745e-1128.03D-3-phosphoglycerate dehydrogenase OS=Bos taurus G... [more]
DDH2_SCHPO6.198e-1130.542-hydroxyacid dehydrogenase homolog 2 OS=Schizosac... [more]
CTBP2_XENLA6.198e-1126.79C-terminal-binding protein 2 OS=Xenopus laevis GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A03EF RVDevelop1 Citrus clementina cDNA clone C32005A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920175 ID=FC920175|Name=FC920175|organism=Citrus clementina|type=EST|length=687bp
GGCTACTCTTAAGAAAACCATCAGGCTTCGCTATGTTAGGAGAACAGTTC
TTTACCTCAAACAAATTCCAATACTTGAAAGCATACGAATCAGCGCTTCC
TCTACACGAATTCTTGACACTACACGCGCACTCAGTGAAGGCCATCTTCT
CCAGCGCAGGTGCGCCGGTTACAGCCGAAATCCTCCGCCTGCTTCCAGAG
GTGCGGCTGGTGGTTGCCACAAGCGCCGGCCTTAACCATATTGACGTAGT
AGAGTGCCGCCGCCGCGGTGTGGCTCTGGCCAATGCTGGTAACGTTTTCT
CTGAAGACGTGGCTGATTACGCACTGGGCTTGCTAATTGATGTCCTGAGA
AAACTTTCTGCTGCCGATTGCTTTGTCAGACAAGGGCTTTGGCCTATCAA
CGCTGAATTTCCGCTTGGGTCTAAGTTGGGTGGCAAACGAGTTGGGATTG
TTGGGCTGGGGAGCATTGGGTCTGAAGTTGCCAAAAGGCTTGAAGCTTTC
GGCTGCTGCGTTTCATACAACTCTAGGAATAAAAAGCCTTCTGTTACGTA
CCCTTTCTATCCGGATGTCTGTGAACTTGCAGCTAACAGTGATGTCCTCA
TCATTTGCTGTGCATTGACTGATCAAACACATCACTTGATCAATAAGCAG
TCTTGTTGGCCCTGGGGAAAGAAGGAGTTATTATTAA
back to top