FC920403

Overview
NameFC920403
Unique NameFC920403
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length689
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..695. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSD_PETHY (Chalcone synthase D OS=Petunia hybrida GN=CHSD PE=3 SV=2)

HSP 1 Score: 300.056 bits (767), Expect = 1.772e-91
Identity = 145/182 (79.67%), Postives = 164/182 (90.11%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M TV+E+RNAQRA+GPATVLAIGTATP++ V+Q+ YPDYYFRIT SEH TELKEKFKR+CDKSMIKKRYM+LTE+ILKENPN+C  MAPSLDAR +I  VEVPKLGKEAA KAI+EW QPKS+ITHL+FCTT+GV MPGAD+QLTKL+GL  SVKRFMM Q GCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVTVEEVRNAQRAEGPATVLAIGTATPSNCVDQSTYPDYYFRITDSEHKTELKEKFKRICDKSMIKKRYMHLTEKILKENPNICESMAPSLDARTNIYAVEVPKLGKEAAEKAIEEWNQPKSRITHLVFCTTTGVSMPGADFQLTKLLGLGSSVKRFMMNQLGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 57.7658 bits (138), Expect = 1.772e-91
Identity = 27/31 (87.10%), Postives = 28/31 (90.32%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSEIT VTFRGP DTH DSLVG
Sbjct:  181 NKGARVLVVCSEITVVTFRGPNDTHFDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS1_DAUCA (Chalcone synthase 1 OS=Daucus carota GN=CHS1 PE=2 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 3.017e-91
Identity = 146/182 (80.22%), Postives = 162/182 (89.01%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M TV E R AQRA+GPATVLAIGTATP + V+Q+ Y DYYFRIT SE   ELKEKF+RMC+KSMI  RYM+LTE++LK+NP+ C YMA SLDARQDIVV EVPKLGKEAA +AIKEWGQPKSKITHLIFCTTSGVDMPGAD++LTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVTVNEFRKAQRAEGPATVLAIGTATPPNCVDQSAYADYYFRITNSEDKPELKEKFRRMCEKSMINTRYMHLTEDLLKQNPSFCEYMASSLDARQDIVVNEVPKLGKEAALRAIKEWGQPKSKITHLIFCTTSGVDMPGADFRLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 56.6102 bits (135), Expect = 3.017e-91
Identity = 26/31 (83.87%), Postives = 28/31 (90.32%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +K ARVLVVCSEIT +TFRGP DTHLDSLVG
Sbjct:  181 NKNARVLVVCSEITVITFRGPNDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS9_DAUCA (Chalcone synthase 9 OS=Daucus carota GN=CHS9 PE=2 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 8.739e-91
Identity = 145/182 (79.67%), Postives = 162/182 (89.01%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M TV E R AQRA+GPATVLAIGTATP + V+Q+ Y DYYFRIT SE   ELKEKF+RMC+KSMI  RYM+LTE++LK+NP+ C YMA SLDARQDIVV EVPKLGKEAA +AIKEWG+PKSKITHLIFCTTSGVDMPGAD++LTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVTVNEFRKAQRAEGPATVLAIGTATPPNCVDQSAYADYYFRITNSEDKPELKEKFRRMCEKSMINTRYMHLTEDLLKQNPSFCEYMASSLDARQDIVVNEVPKLGKEAALRAIKEWGRPKSKITHLIFCTTSGVDMPGADFRLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 56.6102 bits (135), Expect = 8.739e-91
Identity = 26/31 (83.87%), Postives = 28/31 (90.32%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +K ARVLVVCSEIT +TFRGP DTHLDSLVG
Sbjct:  181 NKNARVLVVCSEITVITFRGPNDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: THS2_VITVI (Stilbene synthase 2 OS=Vitis vinifera GN=GSVIVT00004047001 PE=2 SV=2)

HSP 1 Score: 293.893 bits (751), Expect = 1.946e-87
Identity = 138/180 (76.67%), Postives = 162/180 (90.00%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN 592
            MA+V+EIRNAQRA GPAT+LAIGTATP H V Q+DY DYYFR+TKSEHMT LK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVPKLGKEAA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL PSV+R M+Y QGC+AGGTVLR AKDLAEN
Sbjct:    1 MASVEEIRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTALKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLEPSVRRVMLYHQGCYAGGTVLRTAKDLAEN 180          

HSP 2 Score: 50.447 bits (119), Expect = 1.946e-87
Identity = 24/29 (82.76%), Postives = 26/29 (89.66%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDSLVG 684
            GARVLVVCSEIT VTFRGP++  LDSLVG
Sbjct:  183 GARVLVVCSEITVVTFRGPSEDALDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: VPS_HUMLU (Phloroisovalerophenone synthase OS=Humulus lupulus GN=VPS PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 5.635e-87
Identity = 135/180 (75.00%), Postives = 161/180 (89.44%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            TV++IR AQRA+GPAT+LAIGTA PA+  NQAD+PDYYFR+TKSEHMT+LK+KF+RMC+KS IKKRY++LTEE LK+NP++C Y APSL+ RQD++VVEVPKLGKEAA  AIKEWGQPKSKITHLIFCT S +DMPGADYQ  KL+GLRPSVKR M+YQ GC+AGG VLR+AKD+AEN +
Sbjct:    5 TVEQIRKAQRAEGPATILAIGTAVPANCFNQADFPDYYFRVTKSEHMTDLKKKFQRMCEKSTIKKRYLHLTEEHLKQNPHLCEYNAPSLNTRQDMLVVEVPKLGKEAAINAIKEWGQPKSKITHLIFCTGSSIDMPGADYQCAKLLGLRPSVKRVMLYQLGCYAGGKVLRIAKDIAENNK 184          

HSP 2 Score: 51.6026 bits (122), Expect = 5.635e-87
Identity = 23/31 (74.19%), Postives = 27/31 (87.10%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVL+VCSEITA  FRGP++ HLD LVG
Sbjct:  183 NKGARVLIVCSEITACIFRGPSEKHLDCLVG 213          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: THS5_VITVI (Stilbene synthase 5 OS=Vitis vinifera GN=GSVIVT00007357001 PE=3 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 7.351e-87
Identity = 137/180 (76.11%), Postives = 162/180 (90.00%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN 592
            MA+V+EIRNAQRA GPAT+LAIGTATP H V Q+DY DYYF++TKSEHMTELK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVPKLGKEAA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL  SV+R M+Y QGC+AGGTVLR AKDLAEN
Sbjct:    1 MASVEEIRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFKVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAEN 180          

HSP 2 Score: 50.447 bits (119), Expect = 7.351e-87
Identity = 24/29 (82.76%), Postives = 26/29 (89.66%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDSLVG 684
            GARVLVVCSEIT VTFRGP++  LDSLVG
Sbjct:  183 GARVLVVCSEITVVTFRGPSEDALDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: THS4_VITVI (Stilbene synthase 4 OS=Vitis vinifera GN=GSVIVT00005194001 PE=3 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 1.251e-86
Identity = 137/180 (76.11%), Postives = 163/180 (90.56%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN 592
            MA+V+EIRNAQRA GPATVLAIGTATP + + Q+D+ DYYFR+TKSEHMTELK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVPKLGKEAA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL PSV+R M+Y QGC+AGGTVLR AKDLAEN
Sbjct:    1 MASVEEIRNAQRAKGPATVLAIGTATPDNCLYQSDFADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLEPSVRRVMLYHQGCYAGGTVLRTAKDLAEN 180          

HSP 2 Score: 50.447 bits (119), Expect = 1.251e-86
Identity = 24/29 (82.76%), Postives = 26/29 (89.66%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDSLVG 684
            GARVLVVCSEIT VTFRGP++  LDSLVG
Sbjct:  183 GARVLVVCSEITVVTFRGPSEDALDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSF_PETHY (Chalcone synthase F OS=Petunia hybrida GN=CHSF PE=2 SV=2)

HSP 1 Score: 291.582 bits (745), Expect = 1.251e-86
Identity = 138/182 (75.82%), Postives = 160/182 (87.91%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V+E+R AQR +GPAT+LAIGTATP + V+Q  YPDY+FR+T S+H TELKEKFKRM ++SMIKK Y++LTEEILKENP++C + APS DARQDIVVVEVPKLGKEAA  AIKEWGQPKSKITHL+FCTT+GVDM GADYQLTKL+GL PSVKR MMYQ GC+ GGTVLRLAKDLAEN +
Sbjct:    1 MVSVEEVRRAQRREGPATILAIGTATPLNCVDQTTYPDYFFRVTNSDHKTELKEKFKRMFERSMIKKSYLHLTEEILKENPSICEHKAPSFDARQDIVVVEVPKLGKEAAQNAIKEWGQPKSKITHLVFCTTTGVDMHGADYQLTKLLGLSPSVKRLMMYQLGCYGGGTVLRLAKDLAENNK 182          

HSP 2 Score: 50.0618 bits (118), Expect = 1.251e-86
Identity = 23/31 (74.19%), Postives = 26/31 (83.87%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGAR LVVCSEITA+TF  P+DT LD LVG
Sbjct:  181 NKGARALVVCSEITAITFHAPSDTDLDVLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSY_EQUAR (Chalcone synthase OS=Equisetum arvense GN=CHS PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 1.631e-86
Identity = 138/183 (75.41%), Postives = 153/183 (83.61%), Query Frame = 2
Query:   50 EMATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            E A     R AQRA+GPATVLAIGTA PA+   Q+ YPD+YF IT S+HMTELK KF RMC KS IKKRYM+L  EILK NP++CAY   SLD RQDI VVEVPKLGKEA+ KAIKEWGQPKSKITHL+FCTTSGVDMPGAD+ LTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKD+AEN +
Sbjct:    6 ESADASSRRLAQRANGPATVLAIGTANPANVFEQSSYPDFYFDITNSQHMTELKLKFSRMCQKSGIKKRYMHLNSEILKANPSLCAYWEKSLDVRQDIAVVEVPKLGKEASLKAIKEWGQPKSKITHLVFCTTSGVDMPGADWALTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDVAENNK 188          

HSP 2 Score: 58.9214 bits (141), Expect = 1.631e-86
Identity = 27/31 (87.10%), Postives = 30/31 (96.77%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSEIT VTFRGP++THLDSLVG
Sbjct:  187 NKGARVLVVCSEITCVTFRGPSETHLDSLVG 217          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: THS7_VITVI (Stilbene synthase 6 OS=Vitis vinifera GN=STS PE=2 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 1.049e-85
Identity = 134/180 (74.44%), Postives = 161/180 (89.44%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN 592
            MA+V+E RNAQRA GPAT+LAIGTATP H V Q+DY DYYFR+TKSEHMTELK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVP+LG++AA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL  SV+R M+Y QGC+AGGTVLR AKDLAEN
Sbjct:    1 MASVEEFRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPRLGRDAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAEN 180          

HSP 2 Score: 50.447 bits (119), Expect = 1.049e-85
Identity = 24/29 (82.76%), Postives = 26/29 (89.66%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDSLVG 684
            GARVLVVCSEIT VTFRGP++  LDSLVG
Sbjct:  183 GARVLVVCSEITVVTFRGPSEDALDSLVG 211          
The following BLAST results are available for this feature:
BLAST of FC920403 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSD_PETHY1.772e-9179.67Chalcone synthase D OS=Petunia hybrida GN=CHSD PE=... [more]
CHS1_DAUCA3.017e-9180.22Chalcone synthase 1 OS=Daucus carota GN=CHS1 PE=2 ... [more]
CHS9_DAUCA8.739e-9179.67Chalcone synthase 9 OS=Daucus carota GN=CHS9 PE=2 ... [more]
THS2_VITVI1.946e-8776.67Stilbene synthase 2 OS=Vitis vinifera GN=GSVIVT000... [more]
VPS_HUMLU5.635e-8775.00Phloroisovalerophenone synthase OS=Humulus lupulus... [more]
THS5_VITVI7.351e-8776.11Stilbene synthase 5 OS=Vitis vinifera GN=GSVIVT000... [more]
THS4_VITVI1.251e-8676.11Stilbene synthase 4 OS=Vitis vinifera GN=GSVIVT000... [more]
CHSF_PETHY1.251e-8675.82Chalcone synthase F OS=Petunia hybrida GN=CHSF PE=... [more]
CHSY_EQUAR1.631e-8675.41Chalcone synthase OS=Equisetum arvense GN=CHS PE=2... [more]
THS7_VITVI1.049e-8574.44Stilbene synthase 6 OS=Vitis vinifera GN=STS PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H02EF RVDevelop1 Citrus clementina cDNA clone C32007H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920403 ID=FC920403|Name=FC920403|organism=Citrus clementina|type=EST|length=689bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGC
back to top