FC920403

Overview
NameFC920403
Unique NameFC920403
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length689
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..695. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: THS1_VITVI (Stilbene synthase 1 OS=Vitis vinifera GN=VINST1 PE=1 SV=2)

HSP 1 Score: 288.115 bits (736), Expect = 1.049e-85
Identity = 134/180 (74.44%), Postives = 161/180 (89.44%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN 592
            MA+V+E RNAQRA GPAT+LAIGTATP H V Q+DY DYYFR+TKSEHMTELK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVP+LG++AA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL  SV+R M+Y QGC+AGGTVLR AKDLAEN
Sbjct:    1 MASVEEFRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPRLGRDAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAEN 180          

HSP 2 Score: 50.447 bits (119), Expect = 1.049e-85
Identity = 24/29 (82.76%), Postives = 26/29 (89.66%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDSLVG 684
            GARVLVVCSEIT VTFRGP++  LDSLVG
Sbjct:  183 GARVLVVCSEITVVTFRGPSEDALDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS2_HORVU (Chalcone synthase 2 OS=Hordeum vulgare GN=CHS2 PE=2 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 6.737e-85
Identity = 136/179 (75.98%), Postives = 157/179 (87.71%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            ++E+R AQRA+G ATVLAIGTA PA+ V QA YPDYYFR+TKSEH+ +LKEKF+RMCDKSMI+KR+M+LTEEIL +NP +CA+M  SLDAR  I +VEVPKLG+ AA KAIKEWGQP SKITHL+FCTTSGVDMPGADYQLTKL+GL P+VKR MMYQQGCF G TVLRLAKD+AEN R
Sbjct:    6 LKEVRMAQRAEGLATVLAIGTAVPANCVYQATYPDYYFRVTKSEHLADLKEKFQRMCDKSMIRKRHMHLTEEILIKNPKICAHMETSLDARHAIALVEVPKLGQGAAEKAIKEWGQPLSKITHLVFCTTSGVDMPGADYQLTKLLGLSPTVKRLMMYQQGCFGGATVLRLAKDIAENNR 184          

HSP 2 Score: 53.1434 bits (126), Expect = 6.737e-85
Identity = 24/31 (77.42%), Postives = 28/31 (90.32%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITA+ FRGP  +HLDSLVG
Sbjct:  183 NRGARVLVVCSEITAMAFRGPCKSHLDSLVG 213          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: THS3_VITVI (Stilbene synthase 3 (Fragment) OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 1.951e-84
Identity = 134/177 (75.71%), Postives = 158/177 (89.27%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN 592
            V+EIRNAQRA GPAT+LAIGTATP H V Q+DY DYYFR+TKSE M+ELK+KF R+CDKSMIKKRY++LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVPKLGKEAA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL  SV+R M+Y QGC+AGGTVLR AKDLAEN
Sbjct:    1 VEEIRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEPMSELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAEN 177          

HSP 2 Score: 50.447 bits (119), Expect = 1.951e-84
Identity = 24/29 (82.76%), Postives = 26/29 (89.66%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDSLVG 684
            GARVLVVCSEIT VTFRGP++  LDSLVG
Sbjct:  180 GARVLVVCSEITVVTFRGPSEDALDSLVG 208          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: THS3_ARAHY (Stilbene synthase 3 OS=Arachis hypogaea PE=2 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 2.545e-84
Identity = 132/182 (72.53%), Postives = 158/182 (86.81%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V  IR  QRA+GPATVLAIGTA P + ++Q+ Y DYYFR+T SEHMT+LK+KF+R+C+++ IK R+MYLTEEILKENPNMCAY APSLDAR+D+++ EVP++GKEAATKAIKEWGQP SKITHLIFCTTSGV +PG DY+L  L+GL P VKR+MMY QGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVSGIRKVQRAEGPATVLAIGTANPPNCIDQSTYADYYFRVTNSEHMTDLKKKFQRICERTQIKNRHMYLTEEILKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGVDYELIVLLGLDPCVKRYMMYHQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 50.447 bits (119), Expect = 2.545e-84
Identity = 23/31 (74.19%), Postives = 28/31 (90.32%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +K ARVL+VCSE TAVTFRGP++T +DSLVG
Sbjct:  181 NKDARVLIVCSENTAVTFRGPSETDMDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: THS1_ARAHY (Stilbene synthase 1 OS=Arachis hypogaea PE=2 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 3.319e-84
Identity = 133/182 (73.08%), Postives = 158/182 (86.81%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V  IR  QRA+GPATVLAIGTA P + V+Q+ Y DYYFR+T  EHMT+LK+KF+R+C+++ IK R+MYLTEEILKENPNMCAY APSLDAR+D+++ EVP++GKEAATKAIKEWGQP SKITHLIFCTTSGV +PG DY+L  L+GL PSVKR+MMY QGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVSGIRKVQRAEGPATVLAIGTANPPNCVDQSTYADYYFRVTNGEHMTDLKKKFQRICERTQIKNRHMYLTEEILKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGVDYELIVLLGLDPSVKRYMMYHQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 49.2914 bits (116), Expect = 3.319e-84
Identity = 23/31 (74.19%), Postives = 27/31 (87.10%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +K ARVL+VCSE TAVTFRGP +T +DSLVG
Sbjct:  181 NKDARVLIVCSENTAVTFRGPNETDMDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: 2PS_GERHY (2-pyrone synthase OS=Gerbera hybrida GN=2PS PE=1 SV=2)

HSP 1 Score: 279.641 bits (714), Expect = 1.050e-82
Identity = 135/179 (75.42%), Postives = 154/179 (86.03%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            V+ IR A RA G AT+LAIGTATP + V QADY DYYFR+TKSEHM +LKEKFKR+C+K+ IKKRY+ LTE+ L+ENP MC +MAPSL+ARQD+VV  VP LGKEAA KAI EWG PKSKITHLIFCTT+GVDMPGADYQL KL+GL PSVKR+M+YQQGC AGGTVLRLAKDLAEN +
Sbjct:    9 VEVIREAGRAQGLATILAIGTATPPNCVAQADYADYYFRVTKSEHMVDLKEKFKRICEKTAIKKRYLALTEDYLQENPTMCEFMAPSLNARQDLVVTGVPMLGKEAAVKAIDEWGLPKSKITHLIFCTTAGVDMPGADYQLVKLLGLSPSVKRYMLYQQGCAAGGTVLRLAKDLAENNK 187          

HSP 2 Score: 48.9062 bits (115), Expect = 1.050e-82
Identity = 21/30 (70.00%), Postives = 26/30 (86.67%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLV 681
            +KG+RVL+VCSEITA+ F GP + HLDSLV
Sbjct:  186 NKGSRVLIVCSEITAILFHGPNENHLDSLV 215          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: ACS2_RUTGR (Acridone synthase 2 OS=Ruta graveolens GN=ACS2 PE=1 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 6.748e-82
Identity = 128/182 (70.33%), Postives = 158/182 (86.81%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +++E+R AQ+++GPA +LAIGTATP +   QADYPDYYF+ITKSEHMTELK+KFK +C+KSMI+KR+M  ++E LK NP +C +M  SL+ARQDI VVE P++GKEAA KAIKEWG PKS ITHLIFCT++GVDMPGADYQLT+++GL PSVKR M+YQQGC+AGGTVLRLAKDLAEN +
Sbjct:    1 MESLKEMRKAQKSEGPAAILAIGTATPDNVYIQADYPDYYFKITKSEHMTELKDKFKTLCEKSMIRKRHMCFSQEFLKANPEVCKHMGKSLNARQDIAVVETPRIGKEAAVKAIKEWGHPKSSITHLIFCTSAGVDMPGADYQLTRMLGLNPSVKRMMIYQQGCYAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 47.7506 bits (112), Expect = 6.748e-82
Identity = 22/31 (70.97%), Postives = 27/31 (87.10%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KG+RVLVVCSE+TA TFRGP+   +DSLVG
Sbjct:  181 NKGSRVLVVCSELTAPTFRGPSPDAVDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: ACS3_RUTGR (Probable acridone synthase 3 OS=Ruta graveolens GN=ACS3 PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.636e-80
Identity = 126/182 (69.23%), Postives = 156/182 (85.71%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +++E+R AQ ++GPA +LAIGTA P +   QADYPDYYF++TKSEHMTELK+KF+ +C+KSMI+KR+M  +EE LK NP +C +M  SL+ARQDI VVE P+LG EAA KAIKEWGQPKS ITHLIFC+++GVDMPGADYQLT+++GL PSVKR M+YQQGC+AGGTVLRLAKDLAEN +
Sbjct:    1 MESLKEMRKAQMSEGPAAILAIGTANPDNVYMQADYPDYYFKMTKSEHMTELKDKFRTLCEKSMIRKRHMCFSEEFLKANPEVCKHMGKSLNARQDIAVVETPRLGNEAAVKAIKEWGQPKSSITHLIFCSSAGVDMPGADYQLTRILGLNPSVKRMMIYQQGCYAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 47.7506 bits (112), Expect = 1.636e-80
Identity = 22/31 (70.97%), Postives = 27/31 (87.10%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KG+RVLVVCSE+TA TFRGP+   +DSLVG
Sbjct:  181 NKGSRVLVVCSELTAPTFRGPSPDAVDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: ACS4_RUTGR (Probable acridone synthase 4 OS=Ruta graveolens GN=ACS4 PE=2 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 2.784e-80
Identity = 127/182 (69.78%), Postives = 156/182 (85.71%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +++E+R AQ ++GPA +LAIGTATP +   QADYPDYYFR+TKSEHMTELK+KF+ +C+KSMI+KR+M  +EE LK NP +  +M  SL+ARQDI VVE P+LG EAA KAIKEWGQPKS ITHLIFC+++GVDMPGADYQLT+++GL PSVKR M+YQQGC+AGGTVLRLAKDLAEN +
Sbjct:    1 MESLKEMRKAQMSEGPAAILAIGTATPNNVYMQADYPDYYFRMTKSEHMTELKDKFRTLCEKSMIRKRHMCFSEEFLKANPEVSKHMGKSLNARQDIAVVETPRLGNEAAVKAIKEWGQPKSSITHLIFCSSAGVDMPGADYQLTRILGLNPSVKRMMVYQQGCYAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 47.7506 bits (112), Expect = 2.784e-80
Identity = 22/31 (70.97%), Postives = 27/31 (87.10%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KG+RVLVVCSE+TA TFRGP+   +DSLVG
Sbjct:  181 NKGSRVLVVCSELTAPTFRGPSPDAVDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSG_PETHY (Chalcone synthase G OS=Petunia hybrida GN=CHSG PE=2 SV=2)

HSP 1 Score: 281.567 bits (719), Expect = 1.371e-79
Identity = 134/182 (73.63%), Postives = 157/182 (86.26%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            MATV+EIR AQRA+GPATVLAIGTA P++ V+Q+ YPD+ FRIT S+H TELKEKFK MC+ SMIKKRY++LTEEILK NPN+C + APSL+ARQ+I V E PKLGK AA KAI+EW Q KSKITHL+FCTT+ V++PGADYQLTKL+GL PSVKR MMYQQGC+ GGT LRLAKDLAEN +
Sbjct:    1 MATVEEIRKAQRAEGPATVLAIGTANPSNCVDQSAYPDFLFRITTSDHKTELKEKFKHMCEGSMIKKRYLHLTEEILKNNPNICEHKAPSLNARQEIAVAEAPKLGKRAAQKAIEEWSQSKSKITHLVFCTTTSVELPGADYQLTKLLGLSPSVKRSMMYQQGCYGGGTALRLAKDLAENNK 182          

HSP 2 Score: 36.5798 bits (83), Expect = 1.371e-79
Identity = 21/34 (61.76%), Postives = 26/34 (76.47%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPA--DT-HLDSLVG 684
            +KGARVLVVC EIT ++F+ P+  DT  LD LVG
Sbjct:  181 NKGARVLVVCVEITVMSFQAPSRNDTDELDVLVG 214          
The following BLAST results are available for this feature:
BLAST of FC920403 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
THS1_VITVI1.049e-8574.44Stilbene synthase 1 OS=Vitis vinifera GN=VINST1 PE... [more]
CHS2_HORVU6.737e-8575.98Chalcone synthase 2 OS=Hordeum vulgare GN=CHS2 PE=... [more]
THS3_VITVI1.951e-8475.71Stilbene synthase 3 (Fragment) OS=Vitis vinifera P... [more]
THS3_ARAHY2.545e-8472.53Stilbene synthase 3 OS=Arachis hypogaea PE=2 SV=1[more]
THS1_ARAHY3.319e-8473.08Stilbene synthase 1 OS=Arachis hypogaea PE=2 SV=1[more]
2PS_GERHY1.050e-8275.422-pyrone synthase OS=Gerbera hybrida GN=2PS PE=1 S... [more]
ACS2_RUTGR6.748e-8270.33Acridone synthase 2 OS=Ruta graveolens GN=ACS2 PE=... [more]
ACS3_RUTGR1.636e-8069.23Probable acridone synthase 3 OS=Ruta graveolens GN... [more]
ACS4_RUTGR2.784e-8069.78Probable acridone synthase 4 OS=Ruta graveolens GN... [more]
CHSG_PETHY1.371e-7973.63Chalcone synthase G OS=Petunia hybrida GN=CHSG PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H02EF RVDevelop1 Citrus clementina cDNA clone C32007H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920403 ID=FC920403|Name=FC920403|organism=Citrus clementina|type=EST|length=689bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGC
back to top