FC920403

Overview
NameFC920403
Unique NameFC920403
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length689
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..695. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSA_IPOCO (Chalcone synthase A (Fragment) OS=Ipomoea cordatotriloba GN=CHSA PE=3 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 3.025e-70
Identity = 121/173 (69.94%), Postives = 145/173 (83.82%), Query Frame = 2
Query:   80 AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            A+R +G A +LAIGTATP + V+QA YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR++ LTEE+LKENPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRL K LAEN +
Sbjct:   14 AKRFEGHAKLLAIGTATPTNWVDQATYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKRHLVLTEELLKENPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLVKGLAENNK 186          

HSP 2 Score: 35.4242 bits (80), Expect = 3.025e-70
Identity = 18/30 (60.00%), Postives = 22/30 (73.33%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLV 681
            +KGARVLVVCS IT   FRGP+    D+L+
Sbjct:  185 NKGARVLVVCSGITINIFRGPSLEQDDNLL 214          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSB_IPONI (Chalcone synthase B (Fragment) OS=Ipomoea nil GN=CHSB PE=3 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 6.710e-70
Identity = 118/173 (68.21%), Postives = 146/173 (84.39%), Query Frame = 2
Query:   80 AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            A++ +G A + AIGTATPA+ V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I+KR++ LTEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAE+ +
Sbjct:   16 AKKLEGDAKIWAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIRKRHLVLTEELLKKNPNLCTYNETSLNTRQDILVAEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAESNK 188          

HSP 2 Score: 35.4242 bits (80), Expect = 6.710e-70
Identity = 17/30 (56.67%), Postives = 22/30 (73.33%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLV 681
            +KG RVLVVC+EIT   FRGP+    D+L+
Sbjct:  187 NKGGRVLVVCAEITINIFRGPSLEQDDNLL 216          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSB_IPOTF (Chalcone synthase B (Fragment) OS=Ipomoea trifida GN=CHSB PE=3 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 8.750e-70
Identity = 122/177 (68.93%), Postives = 147/177 (83.05%), Query Frame = 2
Query:   74 RNAQR--ADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            R A+R   +G A +LAIGTATPA+ V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I+KR+M LTEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIK WG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAEN +
Sbjct:   14 RRAKRFEIEGYAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSNIRKRHMVLTEELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKVWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNK 190          

HSP 2 Score: 36.5798 bits (83), Expect = 8.750e-70
Identity = 17/30 (56.67%), Postives = 22/30 (73.33%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLV 681
            +KGARVLVVCSE+    FRGP+    D+L+
Sbjct:  189 NKGARVLVVCSEVMLSVFRGPSLQQEDNLL 218          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSC_IPOPU (Chalcone synthase C (Fragment) OS=Ipomoea purpurea GN=CHSC PE=3 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 3.301e-69
Identity = 118/175 (67.43%), Postives = 144/175 (82.29%), Query Frame = 2
Query:   74 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            R  +R DG A +LAIGTA PA+ V+Q  YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCT+SGVDMPGAD+QL KL+GL  SV R MMYQQGC AG  +LRLAKDLAEN +
Sbjct:   14 RREKRFDGHAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEYKEKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVNRLMMYQQGCNAGAVMLRLAKDLAENNK 188          

HSP 2 Score: 35.039 bits (79), Expect = 3.301e-69
Identity = 16/30 (53.33%), Postives = 21/30 (70.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLV 681
            +KG RVLVVCSE+    FRGP+    D+L+
Sbjct:  187 NKGGRVLVVCSEVMLSVFRGPSLQQEDNLL 216          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSA_IPOTR (Chalcone synthase A (Fragment) OS=Ipomoea triloba GN=CHSA PE=3 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 5.613e-69
Identity = 118/173 (68.21%), Postives = 144/173 (83.24%), Query Frame = 2
Query:   80 AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            A+R +G A +LAIGTATP + V+QA YPD+YFRIT SE + E KEKF+R+C+KS I+ R++ LTEE+LK++PN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRL KDLAEN +
Sbjct:   14 AKRFEGHAKLLAIGTATPTNWVDQATYPDFYFRITNSERLLEHKEKFRRICNKSKIRFRHLVLTEELLKKSPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLVKDLAENNK 186          

HSP 2 Score: 38.1206 bits (87), Expect = 5.613e-69
Identity = 19/30 (63.33%), Postives = 23/30 (76.67%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLV 681
            +KGARVLVVCSEIT   FRGP+    D+L+
Sbjct:  185 NKGARVLVVCSEITINIFRGPSLEQDDNLL 214          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSB_IPOTR (Chalcone synthase B (Fragment) OS=Ipomoea triloba GN=CHSB PE=3 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 2.760e-68
Identity = 118/177 (66.67%), Postives = 148/177 (83.62%), Query Frame = 2
Query:   74 RNAQR--ADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            R A+R   +G A +LAIGTATPA+ V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I+KR++ LTEE+L++NP++C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD++LTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAE+ +
Sbjct:   14 RRAKRFEIEGYAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIRKRHLVLTEELLQKNPSLCTYNETSLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFRLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAESNK 190          

HSP 2 Score: 36.1946 bits (82), Expect = 2.760e-68
Identity = 17/30 (56.67%), Postives = 22/30 (73.33%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLV 681
            +KG R+LVVCSEIT   FRGP+    D+L+
Sbjct:  189 NKGGRILVVCSEITINIFRGPSLEQDDNLL 218          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSA_IPONI (Chalcone synthase A (Fragment) OS=Ipomoea nil GN=CHSA PE=3 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 2.762e-68
Identity = 117/175 (66.86%), Postives = 144/175 (82.29%), Query Frame = 2
Query:   74 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            R  +R +G A +LAIGTA PA+ V+Q  YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCT+SGVDMPGAD+QL KL+GL  SV R MMYQQGC AG  +LRLAKDLAEN +
Sbjct:   11 RREKRIEGHAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVNRLMMYQQGCNAGAAMLRLAKDLAENNK 185          

HSP 2 Score: 33.4982 bits (75), Expect = 2.762e-68
Identity = 16/30 (53.33%), Postives = 20/30 (66.67%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLV 681
            +KG RVLVVCSE+    FRGP+    D L+
Sbjct:  184 NKGGRVLVVCSEVMLNVFRGPSLEQEDYLL 213          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: BBS_PHASS (Bibenzyl synthase OS=Phalaenopsis sp. GN=BIBSY212 PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 2.307e-67
Identity = 106/182 (58.24%), Postives = 146/182 (80.22%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +++ I+ A RADG A++LAIG A P + + Q+ YPD+YFR+T SEH+ +LK+KF+R+C+K+ I+KR+    EE L  NP    +M  SL+ RQ++ + E+PKLG +AATKAI++WGQPKS+ITHLIFCTTSG+D+PGADYQLT+++GL P+V+R M+YQQGCFAGGT LRLAK LAE+ +
Sbjct:    1 MLSLESIKKAPRADGFASILAIGRANPDNIIEQSAYPDFYFRVTNSEHLVDLKKKFQRICEKTAIRKRHFVWNEEFLTANPCFSTFMDKSLNVRQEVAISEIPKLGAKAATKAIEDWGQPKSRITHLIFCTTSGMDLPGADYQLTQILGLNPNVERVMLYQQGCFAGGTTLRLAKCLAESRK 182          

HSP 2 Score: 42.3578 bits (98), Expect = 2.307e-67
Identity = 19/29 (65.52%), Postives = 22/29 (75.86%), Query Frame = 1
Query:  595 KGARVLVVCSEITAVTFRGPADTHLDSLV 681
            KGARVLVVC+E T V FR P++ H D LV
Sbjct:  182 KGARVLVVCAETTTVLFRAPSEEHQDDLV 210          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: VPS_PSINU (Phloroisovalerophenone synthase OS=Psilotum nudum GN=VPS PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 3.922e-67
Identity = 111/175 (63.43%), Postives = 139/175 (79.43%), Query Frame = 2
Query:   74 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            R  +RA GP +VLAIG+A P +  +Q+ +PD+YF IT+S HM E+K KF RMC KS IKKR M++ E+IL+ +P++ +Y   SLD RQD++V EVPKLGK AA  AI EWGQPKS ITHLIFCT+SG+DMPGAD+ L KL+GLRP+V R M+YQQGCFAG TVLR+AKDLAEN +
Sbjct:   15 RKKERASGPVSVLAIGSANPPNVFHQSLFPDFYFNITQSNHMAEVKAKFTRMCAKSGIKKRRMHINEDILEAHPSIRSYHDNSLDVRQDMLVEEVPKLGKVAADNAIAEWGQPKSNITHLIFCTSSGIDMPGADWALMKLLGLRPTVNRVMVYQQGCFAGCTVLRIAKDLAENNK 189          

HSP 2 Score: 46.2098 bits (108), Expect = 3.922e-67
Identity = 18/31 (58.06%), Postives = 27/31 (87.10%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KG+R+LVVCSE+T ++FRGP + H ++LVG
Sbjct:  188 NKGSRILVVCSELTLISFRGPTEDHPENLVG 218          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: TBSYN_HYPAN (Trihydroxybenzophenone synthase OS=Hypericum androsaemum PE=1 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 3.923e-67
Identity = 114/164 (69.51%), Postives = 132/164 (80.49%), Query Frame = 2
Query:  101 ATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN 592
            A+VLAIGT  P H + Q DYPD+YFR T SEHMTELKEKFKR+C KS I+KR+ YLTEEILKEN  +  Y A SLDARQ I+  EVPKLG+EAA KAI EWGQP SKITH++F TTSG  MPGADY +T+L+GL  +V+R M+Y QGCFAGGT LR+AKDLAEN
Sbjct:   20 ASVLAIGTTNPEHFILQEDYPDFYFRNTNSEHMTELKEKFKRICVKSHIRKRHFYLTEEILKENQGIATYGAGSLDARQRILETEVPKLGQEAALKAIAEWGQPISKITHVVFATTSGFMMPGADYVITRLLGLNRTVRRVMLYNQGCFAGGTALRVAKDLAEN 183          

HSP 2 Score: 43.8986 bits (102), Expect = 3.923e-67
Identity = 19/31 (61.29%), Postives = 26/31 (83.87%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVC+E TA+TF  P ++HLD +VG
Sbjct:  184 NEGARVLVVCAENTAMTFHAPNESHLDVIVG 214          
The following BLAST results are available for this feature:
BLAST of FC920403 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSA_IPOCO3.025e-7069.94Chalcone synthase A (Fragment) OS=Ipomoea cordatot... [more]
CHSB_IPONI6.710e-7068.21Chalcone synthase B (Fragment) OS=Ipomoea nil GN=C... [more]
CHSB_IPOTF8.750e-7068.93Chalcone synthase B (Fragment) OS=Ipomoea trifida ... [more]
CHSC_IPOPU3.301e-6967.43Chalcone synthase C (Fragment) OS=Ipomoea purpurea... [more]
CHSA_IPOTR5.613e-6968.21Chalcone synthase A (Fragment) OS=Ipomoea triloba ... [more]
CHSB_IPOTR2.760e-6866.67Chalcone synthase B (Fragment) OS=Ipomoea triloba ... [more]
CHSA_IPONI2.762e-6866.86Chalcone synthase A (Fragment) OS=Ipomoea nil GN=C... [more]
BBS_PHASS2.307e-6758.24Bibenzyl synthase OS=Phalaenopsis sp. GN=BIBSY212 ... [more]
VPS_PSINU3.922e-6763.43Phloroisovalerophenone synthase OS=Psilotum nudum ... [more]
TBSYN_HYPAN3.923e-6769.51Trihydroxybenzophenone synthase OS=Hypericum andro... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H02EF RVDevelop1 Citrus clementina cDNA clone C32007H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920403 ID=FC920403|Name=FC920403|organism=Citrus clementina|type=EST|length=689bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGC
back to top