FC920403

Overview
NameFC920403
Unique NameFC920403
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length689
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..695. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS2_SORBI (Chalcone synthase 2 OS=Sorghum bicolor GN=CHS2 PE=3 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 5.054e-100
Identity = 159/180 (88.33%), Postives = 169/180 (93.89%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAEN R
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNR 186          

HSP 2 Score: 56.9954 bits (136), Expect = 5.054e-100
Identity = 25/31 (80.65%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+++HLDS+VG
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSESHLDSMVG 215          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS1_SORBI (Chalcone synthase 1 OS=Sorghum bicolor GN=CHS1 PE=3 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 5.054e-100
Identity = 159/180 (88.33%), Postives = 169/180 (93.89%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAEN R
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNR 186          

HSP 2 Score: 56.9954 bits (136), Expect = 5.054e-100
Identity = 25/31 (80.65%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+++HLDS+VG
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSESHLDSMVG 215          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSY_CALCH (Chalcone synthase OS=Callistephus chinensis GN=CHS PE=2 SV=2)

HSP 1 Score: 325.479 bits (833), Expect = 5.054e-100
Identity = 156/179 (87.15%), Postives = 168/179 (93.85%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            +  IR AQR  GPAT+LAIGTATP++ V QADYPDYYFRITKSEHM +LKEKFKRMCDKSMI+KRYM+LTEE LKENP++C YMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    7 IAAIREAQRRQGPATILAIGTATPSNCVYQADYPDYYFRITKSEHMVDLKEKFKRMCDKSMIRKRYMHLTEEYLKENPSLCEYMAPSLDARQDVVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNK 185          

HSP 2 Score: 60.8474 bits (146), Expect = 5.054e-100
Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSEITAVTFRGP DTHLDSLVG
Sbjct:  184 NKGARVLVVCSEITAVTFRGPNDTHLDSLVG 214          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSA_SOLTU (Chalcone synthase 1A OS=Solanum tuberosum GN=CHS1A PE=2 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 5.055e-100
Identity = 157/182 (86.26%), Postives = 169/182 (92.86%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M TV+E R AQRA+GPAT+LAIGT+TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMCDKSMIKKRYM+LTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPG DYQL KL+GLRPSVKR MMYQQGCF GGTVLRLAKDLAEN +
Sbjct:    1 MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFVGGTVLRLAKDLAENNK 182          

HSP 2 Score: 58.9214 bits (141), Expect = 5.055e-100
Identity = 27/31 (87.10%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSEITAVTFRGP+++HLDSLVG
Sbjct:  181 NKGARVLVVCSEITAVTFRGPSESHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS5_SORBI (Chalcone synthase 5 OS=Sorghum bicolor GN=CHS5 PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 6.594e-100
Identity = 159/180 (88.33%), Postives = 169/180 (93.89%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAEN R
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAHKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNR 186          

HSP 2 Score: 56.9954 bits (136), Expect = 6.594e-100
Identity = 25/31 (80.65%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+++HLDS+VG
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSESHLDSMVG 215          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSA_PETHY (Chalcone synthase A OS=Petunia hybrida GN=CHSA PE=2 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 8.604e-100
Identity = 156/182 (85.71%), Postives = 169/182 (92.86%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M TV+E R AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEH T+LKEKFKRMC+KSMIKKRYM+LTEEILKENP+MC YMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPG DYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVTVEEYRKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 60.8474 bits (146), Expect = 8.604e-100
Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSEITAVTFRGP DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEITAVTFRGPNDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSA_PEA (Chalcone synthase 1A OS=Pisum sativum GN=CHS-1A PE=3 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 8.604e-100
Identity = 156/182 (85.71%), Postives = 169/182 (92.86%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M TV EIR AQRA+GPATV AIGTATP + V Q+ YPD+YFRIT S+H TELKEKF+RMCDKSMIKKRYM+LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVTVNEIRQAQRAEGPATVFAIGTATPQNCVEQSTYPDFYFRITNSQHKTELKEKFQRMCDKSMIKKRYMHLTEEILKENPSLCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 62.003 bits (149), Expect = 8.604e-100
Identity = 29/31 (93.55%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSEITAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEITAVTFRGPSDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS7_SOYBN (Chalcone synthase 7 OS=Glycine max GN=CHS7 PE=3 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 8.604e-100
Identity = 156/182 (85.71%), Postives = 168/182 (92.31%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V EIR AQRA+GPAT+LAIGTA P + V+Q+ YPDYYFRIT S+HMTELKEKF+RMCDKSMIK RYMYL EEILKENPNMCAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTK +GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVAEIRQAQRAEGPATILAIGTANPPNRVDQSTYPDYYFRITNSDHMTELKEKFQRMCDKSMIKTRYMYLNEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKQLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 62.003 bits (149), Expect = 8.604e-100
Identity = 29/31 (93.55%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSEITAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEITAVTFRGPSDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS3_SORBI (Chalcone synthase 3 OS=Sorghum bicolor GN=CHS3 PE=3 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 1.122e-99
Identity = 158/180 (87.78%), Postives = 169/180 (93.89%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMT+LKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAEN R
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTDLKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNR 186          

HSP 2 Score: 56.9954 bits (136), Expect = 1.122e-99
Identity = 25/31 (80.65%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+++HLDS+VG
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSESHLDSMVG 215          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS7_SORBI (Chalcone synthase 7 OS=Sorghum bicolor GN=CHS7 PE=3 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 1.122e-99
Identity = 158/180 (87.78%), Postives = 169/180 (93.89%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMT+LKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSV R MMYQQGCFAGGTVLR+AKDLAEN R
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTDLKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNR 186          

HSP 2 Score: 56.9954 bits (136), Expect = 1.122e-99
Identity = 25/31 (80.65%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+++HLDS+VG
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSESHLDSMVG 215          
The following BLAST results are available for this feature:
BLAST of FC920403 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS2_SORBI5.054e-10088.33Chalcone synthase 2 OS=Sorghum bicolor GN=CHS2 PE=... [more]
CHS1_SORBI5.054e-10088.33Chalcone synthase 1 OS=Sorghum bicolor GN=CHS1 PE=... [more]
CHSY_CALCH5.054e-10087.15Chalcone synthase OS=Callistephus chinensis GN=CHS... [more]
CHSA_SOLTU5.055e-10086.26Chalcone synthase 1A OS=Solanum tuberosum GN=CHS1A... [more]
CHS5_SORBI6.594e-10088.33Chalcone synthase 5 OS=Sorghum bicolor GN=CHS5 PE=... [more]
CHSA_PETHY8.604e-10085.71Chalcone synthase A OS=Petunia hybrida GN=CHSA PE=... [more]
CHSA_PEA8.604e-10085.71Chalcone synthase 1A OS=Pisum sativum GN=CHS-1A PE... [more]
CHS7_SOYBN8.604e-10085.71Chalcone synthase 7 OS=Glycine max GN=CHS7 PE=3 SV... [more]
CHS3_SORBI1.122e-9987.78Chalcone synthase 3 OS=Sorghum bicolor GN=CHS3 PE=... [more]
CHS7_SORBI1.122e-9987.78Chalcone synthase 7 OS=Sorghum bicolor GN=CHS7 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H02EF RVDevelop1 Citrus clementina cDNA clone C32007H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920403 ID=FC920403|Name=FC920403|organism=Citrus clementina|type=EST|length=689bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGC
back to top