FC920403

Overview
NameFC920403
Unique NameFC920403
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length689
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..695. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS3_CAMSI (Chalcone synthase 3 OS=Camellia sinensis GN=CHS3 PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 1.122e-99
Identity = 157/182 (86.26%), Postives = 168/182 (92.31%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M TV+++  AQRA GPATVLAIGTATP + V+Q+ YPDYYFRIT SEH  ELKEKFKRMCDKSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVTVEDVWRAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCDKSMIKKRYMYLTEEILKENPLVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 62.003 bits (149), Expect = 1.122e-99
Identity = 29/31 (93.55%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSEITAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEITAVTFRGPSDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS7_PICMA (Chalcone synthase 7 OS=Picea mariana GN=CSF7 PE=2 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 1.464e-99
Identity = 155/182 (85.16%), Postives = 171/182 (93.96%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            MA ++  R AQRADGPAT+LAIGTATP ++V+Q+ YPDYYF+IT SEHMTELKEKF+RMCDKS IKKRYMYLT+EILKENPN+C YMAPSLDARQD+VVVEVP+LGKEAATKAIKEWGQPKSKITH+IFCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKDLAEN R
Sbjct:    6 MADLEAFRKAQRADGPATILAIGTATPPNAVDQSTYPDYYFKITNSEHMTELKEKFQRMCDKSAIKKRYMYLTDEILKENPNVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHVIFCTTSGVDMPGADYQLTKLLGLRPSVKRVMMYQQGCFAGGTVLRVAKDLAENNR 187          

HSP 2 Score: 60.077 bits (144), Expect = 1.464e-99
Identity = 27/31 (87.10%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+DTHLDS+VG
Sbjct:  186 NRGARVLVVCSEITAVTFRGPSDTHLDSMVG 216          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSY_RAPSA (Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 1.464e-99
Identity = 156/181 (86.19%), Postives = 169/181 (93.37%), Query Frame = 2
Query:   56 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            +++ EIR AQRADGPA +LAIGTA PA+ V QA+YPDYYFRIT SEHMT+LKEKFKRMCDKS I+KR+M+LTEE LKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAEN R
Sbjct:    6 SSLDEIRKAQRADGPAGILAIGTANPANHVLQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNR 186          

HSP 2 Score: 60.8474 bits (146), Expect = 1.464e-99
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+DTHLDSLVG
Sbjct:  185 NRGARVLVVCSEITAVTFRGPSDTHLDSLVG 215          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS1_CITSI (Chalcone synthase 1 OS=Citrus sinensis GN=CHS1 PE=2 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 1.911e-99
Identity = 155/182 (85.16%), Postives = 170/182 (93.41%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M TV E+R AQRA GPAT++AIGTATP + V+Q+ YPDYYFRIT SEHMT+LKEKFKRMCDKSMIKKRYMYLTEEILKENPN+CAYMAPSLD RQD+VVVEVP+LGK AAT+AIKEWGQPKSKITHL+FCTTSGVDMPGADY+LTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVTVDEVRKAQRAQGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCDKSMIKKRYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGK-AATEAIKEWGQPKSKITHLVFCTTSGVDMPGADYRLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 181          

HSP 2 Score: 62.003 bits (149), Expect = 1.911e-99
Identity = 29/31 (93.55%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSEITAVTFRGP+DTHLDSLVG
Sbjct:  180 NKGARVLVVCSEITAVTFRGPSDTHLDSLVG 210          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSY_CARAN (Chalcone synthase OS=Cardamine amara GN=CHS PE=3 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 2.492e-99
Identity = 156/180 (86.67%), Postives = 168/180 (93.33%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            ++ EIR AQRADGPA +LAIGTA PA+ V QA+YPDYYFRIT SEHMT+LKEKFKRMCDKS I+KR+M++TEE LKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAEN R
Sbjct:    8 SLDEIRKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNR 187          

HSP 2 Score: 60.8474 bits (146), Expect = 2.492e-99
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+DTHLDSLVG
Sbjct:  186 NRGARVLVVCSEITAVTFRGPSDTHLDSLVG 216          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS2_SECCE (Chalcone synthase 2 OS=Secale cereale GN=CHS2 PE=2 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 2.492e-99
Identity = 156/180 (86.67%), Postives = 171/180 (95.00%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            TV+E+R AQRA+GPATVLAIGTATPA+ V QADYPDYYF+ITKS+HM +LKEKFKRMCDKS I+KRYM+LTEEIL++NPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQP+SKITHL+FCTTSGVDMPGADYQLTK++GLRPSVKR MMYQQGCFAGGTVLRLAKDLAEN R
Sbjct:    6 TVEEVRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFKITKSDHMADLKEKFKRMCDKSQIRKRYMHLTEEILQDNPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPRSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNR 185          

HSP 2 Score: 56.6102 bits (135), Expect = 2.492e-99
Identity = 26/31 (83.87%), Postives = 30/31 (96.77%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP ++HLDSLVG
Sbjct:  184 NRGARVLVVCSEITAVTFRGPHESHLDSLVG 214          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSY_CHRAE (Chalcone synthase OS=Chrysosplenium americanum GN=CHS PE=2 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 3.252e-99
Identity = 155/181 (85.64%), Postives = 169/181 (93.37%), Query Frame = 2
Query:   56 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            A ++EIRNAQRA+GPAT+LAIGTATPA+ V QADYPD+YFRIT SEH TELKEKF+RMCDKSMIKKRYM+LTE++LKENP MC YMAPSLDARQD+VVVE+ KLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCF GGTVLRLAKDLAEN R
Sbjct:    5 ALMEEIRNAQRAEGPATILAIGTATPANCVIQADYPDFYFRITNSEHKTELKEKFQRMCDKSMIKKRYMHLTEDLLKENPKMCEYMAPSLDARQDMVVVEIRKLGKEAAVKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFPGGTVLRLAKDLAENNR 185          

HSP 2 Score: 60.8474 bits (146), Expect = 3.252e-99
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+DTHLDSLVG
Sbjct:  184 NRGARVLVVCSEITAVTFRGPSDTHLDSLVG 214          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS3_SINAL (Chalcone synthase 3 OS=Sinapis alba GN=CHS3 PE=2 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 3.252e-99
Identity = 155/181 (85.64%), Postives = 169/181 (93.37%), Query Frame = 2
Query:   56 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            +++ EIR AQRADGPA +LAIGTA PA+ V QA+YPDYYFRIT SEHMT+LKEKFKRMCDKS I+KR+M+LTEE LK+NPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAEN R
Sbjct:    7 SSLDEIRKAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKDNPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNR 187          

HSP 2 Score: 60.8474 bits (146), Expect = 3.252e-99
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+DTHLDSLVG
Sbjct:  186 NRGARVLVVCSEITAVTFRGPSDTHLDSLVG 216          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS1_SINAL (Chalcone synthase 1 OS=Sinapis alba GN=CHS1 PE=2 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 3.252e-99
Identity = 155/181 (85.64%), Postives = 169/181 (93.37%), Query Frame = 2
Query:   56 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            +++ EIR AQRADGPA +LAIGTA PA+ V QA+YPDYYFRIT SEHMT+LKEKFKRMCDKS I+KR+M+LTEE LK+NPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAEN R
Sbjct:    7 SSLDEIRKAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKDNPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNR 187          

HSP 2 Score: 60.8474 bits (146), Expect = 3.252e-99
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+DTHLDSLVG
Sbjct:  186 NRGARVLVVCSEITAVTFRGPSDTHLDSLVG 216          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS6_TRISU (Chalcone synthase 6 OS=Trifolium subterraneum GN=CHS6 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 5.535e-99
Identity = 154/182 (84.62%), Postives = 168/182 (92.31%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V EIR AQRA+GPAT+LAIGTA PA+ V QA YPD+YF+IT SEH TELKEKF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVAEIRKAQRAEGPATILAIGTANPANKVEQATYPDFYFKITNSEHKTELKEKFQRMCDKSMIKSRYMYLTEEILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 61.6178 bits (148), Expect = 5.535e-99
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSE+TAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEVTAVTFRGPSDTHLDSLVG 211          
The following BLAST results are available for this feature:
BLAST of FC920403 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS3_CAMSI1.122e-9986.26Chalcone synthase 3 OS=Camellia sinensis GN=CHS3 P... [more]
CHS7_PICMA1.464e-9985.16Chalcone synthase 7 OS=Picea mariana GN=CSF7 PE=2 ... [more]
CHSY_RAPSA1.464e-9986.19Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 ... [more]
CHS1_CITSI1.911e-9985.16Chalcone synthase 1 OS=Citrus sinensis GN=CHS1 PE=... [more]
CHSY_CARAN2.492e-9986.67Chalcone synthase OS=Cardamine amara GN=CHS PE=3 S... [more]
CHS2_SECCE2.492e-9986.67Chalcone synthase 2 OS=Secale cereale GN=CHS2 PE=2... [more]
CHSY_CHRAE3.252e-9985.64Chalcone synthase OS=Chrysosplenium americanum GN=... [more]
CHS3_SINAL3.252e-9985.64Chalcone synthase 3 OS=Sinapis alba GN=CHS3 PE=2 S... [more]
CHS1_SINAL3.252e-9985.64Chalcone synthase 1 OS=Sinapis alba GN=CHS1 PE=2 S... [more]
CHS6_TRISU5.535e-9984.62Chalcone synthase 6 OS=Trifolium subterraneum GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H02EF RVDevelop1 Citrus clementina cDNA clone C32007H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920403 ID=FC920403|Name=FC920403|organism=Citrus clementina|type=EST|length=689bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGC
back to top