FC920403

Overview
NameFC920403
Unique NameFC920403
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length689
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..695. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS3_PEA (Chalcone synthase 3 OS=Pisum sativum GN=CHS3 PE=3 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 3.561e-98
Identity = 152/182 (83.52%), Postives = 168/182 (92.31%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YFRIT SEH TELK+KF+RMCDKSMI +RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFRITNSEHKTELKQKFQRMCDKSMINRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 61.6178 bits (148), Expect = 3.561e-98
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSE+TAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEVTAVTFRGPSDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS7_IPOBA (Chalcone synthase DIII OS=Ipomoea batatas GN=CHS-DIII PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 4.645e-98
Identity = 154/182 (84.62%), Postives = 167/182 (91.76%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M TV+E+R A+RA+GPAT+LAIGTATPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH+ FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVTVEEVRKAKRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVFFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 58.5362 bits (140), Expect = 4.645e-98
Identity = 26/31 (83.87%), Postives = 30/31 (96.77%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVL+VCSEIT VTFRGP++THLDSLVG
Sbjct:  181 NKGARVLIVCSEITVVTFRGPSETHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS4_IPOBA (Chalcone synthase LF4 OS=Ipomoea batatas GN=CHS-LF4 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 4.645e-98
Identity = 153/182 (84.07%), Postives = 167/182 (91.76%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M TV+E+R AQRA+GPAT+LAIGT TPA+ VNQ+ YPDYYFRIT SEH TELKE+F+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKERFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 58.5362 bits (140), Expect = 4.645e-98
Identity = 26/31 (83.87%), Postives = 30/31 (96.77%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVL+VCSEIT VTFRGP++THLDSLVG
Sbjct:  181 NKGARVLIVCSEITVVTFRGPSETHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS9_MEDSA (Chalcone synthase 9 OS=Medicago sativa GN=CHS9 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 6.060e-98
Identity = 151/182 (82.97%), Postives = 168/182 (92.31%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V EIR AQRA+GPAT++AIGTA PA+ V Q+ YPD+YF+IT SEH  ELKEKF+RMCDKSMIK+RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVSEIRQAQRAEGPATIMAIGTANPANCVEQSTYPDFYFKITNSEHKVELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 61.6178 bits (148), Expect = 6.060e-98
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSE+TAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEVTAVTFRGPSDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS8_MEDSA (Chalcone synthase 8 OS=Medicago sativa GN=CHS8 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 6.060e-98
Identity = 152/182 (83.52%), Postives = 168/182 (92.31%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH TELKEKF+RMCDKSMIK+RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVSEIRTAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 61.6178 bits (148), Expect = 6.060e-98
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSE+TAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEVTAVTFRGPSDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS4_MEDSA (Chalcone synthase 4 OS=Medicago sativa GN=CHS4 PE=2 SV=2)

HSP 1 Score: 317.775 bits (813), Expect = 6.060e-98
Identity = 152/182 (83.52%), Postives = 168/182 (92.31%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH TELKEKF+RMCDKSMIK+RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 61.6178 bits (148), Expect = 6.060e-98
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSE+TAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEVTAVTFRGPSDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSY_ARAAL (Chalcone synthase OS=Arabis alpina GN=CHS PE=3 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 7.906e-98
Identity = 152/180 (84.44%), Postives = 166/180 (92.22%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            +++EIR AQRADGPA +L IGTA P + V QA+YPDYYFRIT S+HMT+LKEKFKRMCDKSMI+KR+M+LTEE LKENP MCAYMAPSLD RQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAEN R
Sbjct:    4 SLEEIRKAQRADGPAGILGIGTANPPNHVLQAEYPDYYFRITNSDHMTDLKEKFKRMCDKSMIRKRHMHLTEEFLKENPKMCAYMAPSLDTRQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNR 183          

HSP 2 Score: 60.8474 bits (146), Expect = 7.906e-98
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+DTHLDSLVG
Sbjct:  182 NRGARVLVVCSEITAVTFRGPSDTHLDSLVG 212          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSY_ARATH (Chalcone synthase OS=Arabidopsis thaliana GN=CHS PE=1 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 1.031e-97
Identity = 152/181 (83.98%), Postives = 167/181 (92.27%), Query Frame = 2
Query:   56 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            +++ EIR AQRADGPA +LAIGTA P + V QA+YPDYYFRIT SEHMT+LKEKFKRMCDKS I+KR+M+LTEE LKENP+MCAYMAPSLD RQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKDLAEN R
Sbjct:    7 SSLDEIRQAQRADGPAGILAIGTANPENHVLQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKENPHMCAYMAPSLDTRQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRIAKDLAENNR 187          

HSP 2 Score: 60.8474 bits (146), Expect = 1.031e-97
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSEITAVTFRGP+DTHLDSLVG
Sbjct:  186 NRGARVLVVCSEITAVTFRGPSDTHLDSLVG 216          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS2_IPOBA (Chalcone synthase LF2 OS=Ipomoea batatas GN=CHS-LF2 PE=2 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.031e-97
Identity = 153/182 (84.07%), Postives = 166/182 (91.21%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M TV+E+R AQRA+GPAT+LAIGT TPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GL PSVKR MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLSPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 58.5362 bits (140), Expect = 1.031e-97
Identity = 26/31 (83.87%), Postives = 30/31 (96.77%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVL+VCSEIT VTFRGP++THLDSLVG
Sbjct:  181 NKGARVLIVCSEITVVTFRGPSETHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSD_IPONI (Chalcone synthase D OS=Ipomoea nil GN=CHSD PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 1.032e-97
Identity = 154/183 (84.15%), Postives = 171/183 (93.44%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTRA 601
            M TV+E+R AQRA+GPAT+LAIGTATPA+ V+Q+ YPDYYFRIT S+HMT+LK+KF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDIVVVEVPKLGKEAA  AIKEWGQPKSKITH+IFCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKDLAEN +A
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITNSDHMTDLKQKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKA 183          

HSP 2 Score: 55.4546 bits (132), Expect = 1.032e-97
Identity = 26/31 (83.87%), Postives = 28/31 (90.32%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +K ARVLVVCSEIT VTFRGP +THLDSLVG
Sbjct:  181 NKAARVLVVCSEITVVTFRGPNETHLDSLVG 211          
The following BLAST results are available for this feature:
BLAST of FC920403 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS3_PEA3.561e-9883.52Chalcone synthase 3 OS=Pisum sativum GN=CHS3 PE=3 ... [more]
CHS7_IPOBA4.645e-9884.62Chalcone synthase DIII OS=Ipomoea batatas GN=CHS-D... [more]
CHS4_IPOBA4.645e-9884.07Chalcone synthase LF4 OS=Ipomoea batatas GN=CHS-LF... [more]
CHS9_MEDSA6.060e-9882.97Chalcone synthase 9 OS=Medicago sativa GN=CHS9 PE=... [more]
CHS8_MEDSA6.060e-9883.52Chalcone synthase 8 OS=Medicago sativa GN=CHS8 PE=... [more]
CHS4_MEDSA6.060e-9883.52Chalcone synthase 4 OS=Medicago sativa GN=CHS4 PE=... [more]
CHSY_ARAAL7.906e-9884.44Chalcone synthase OS=Arabis alpina GN=CHS PE=3 SV=... [more]
CHSY_ARATH1.031e-9783.98Chalcone synthase OS=Arabidopsis thaliana GN=CHS P... [more]
CHS2_IPOBA1.031e-9784.07Chalcone synthase LF2 OS=Ipomoea batatas GN=CHS-LF... [more]
CHSD_IPONI1.032e-9784.15Chalcone synthase D OS=Ipomoea nil GN=CHSD PE=2 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H02EF RVDevelop1 Citrus clementina cDNA clone C32007H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920403 ID=FC920403|Name=FC920403|organism=Citrus clementina|type=EST|length=689bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGC
back to top