FC920420
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC920420 vs. ExPASy Swiss-Prot
Match: LAR_DESUN (Leucoanthocyanidin reductase OS=Desmodium uncinatum GN=LAR PE=1 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 3.163e-19 Identity = 37/108 (34.26%), Postives = 60/108 (55.56%), Query Frame = 3 Query: 81 KERFYSSAGQGISVKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIK--QVDVGISTDGHTLLADQVKIIAAIKEAGNVKEIL 398 K R G G +F +AS+ G+PTF+LVR +S PSK+ ++ F++ G ++ G + + E + K +K ++DV IS G L DQ+ ++ AIK +K L Sbjct: 12 KNRTLVVGGTGFIGQFITKASLGFGYPTFLLVRPGPVS-PSKAVIIKTFQDKGAKVIYGVINDKECMEKILKEYEIDVVISLVGGARLLDQLTLLEAIKSVKTIKRFL 118 HSP 2 Score: 54.299 bits (129), Expect = 3.163e-19 Identity = 31/72 (43.06%), Postives = 40/72 (55.56%), Query Frame = 1 Query: 382 TLKRFLPSEFGNDVDRVEGAV*PTKSTYDVKAKIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPEATAPPRD 597 T+KRFLPSEFG+DVDR + V P + Y K +RRAVE GIP+T + + + P PP D Sbjct: 113 TIKRFLPSEFGHDVDRTD-PVEPGLTMYKEKRLVRRAVEEYGIPFTNICCNSIASWPYYDNCHPSQVPPPMD 183 The following BLAST results are available for this feature:
BLAST of FC920420 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 11
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC920420 ID=FC920420; Name=FC920420; organism=Citrus clementina; type=EST; length=598bpback to top |