FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP76_PIG (Heat shock 70 kDa protein 6 OS=Sus scrofa GN=HSPA6 PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 5.480e-38
Identity = 76/111 (68.47%), Postives = 93/111 (83.78%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP NTVFDAKRLIGR+F+D +VQ D+K WPF+V++    KP + V+Y+GE+K F  EEISSMVL KM+E AEAYLG  +++AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   62 ALNPQNTVFDAKRLIGRKFADPTVQSDLKHWPFQVVS-EGGKPKVRVSYRGEDKAFYPEEISSMVLSKMKETAEAYLGQPVRHAVITVPAYFNDSQRQATKDAGAIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_HYDMA (Heat shock 70 kDa protein OS=Hydra magnipapillata GN=HSP70.1 PE=3 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 1.221e-37
Identity = 79/112 (70.54%), Postives = 89/112 (79.46%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP+NTVFDAKRLIGR+F+D SV  D K WPF VI     +P I V +KGE K F  EEISSMVL+KM EIA+AYLG  + + V+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   59 VAMNPSNTVFDAKRLIGRKFNDPSVTSDRKHWPFNVI-DDGSRPKIQVEFKGETKSFYPEEISSMVLLKMEEIADAYLGKKVTDVVITVPAYFNDSQRQATKDAGVIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP75_KLULA (Heat shock protein SSB OS=Kluyveromyces lactis GN=SSB PE=3 SV=3)

HSP 1 Score: 154.066 bits (388), Expect = 2.083e-37
Identity = 79/111 (71.17%), Postives = 89/111 (80.18%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP NTVFDAKRLIGRRF + SVQ DMK WPFKVI    D P+I V Y GE K F+ +EISSMVL KM+EIAEA +G  ++ AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   62 ALNPKNTVFDAKRLIGRRFDEESVQSDMKTWPFKVIDSN-DAPLIEVEYLGETKTFSPQEISSMVLTKMKEIAEAKIGKKVEKAVVTVPAYFNDAQRQATKDAGAIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_DANRE (Heat shock cognate 71 kDa protein OS=Danio rerio GN=hspa8 PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.720e-37
Identity = 79/112 (70.54%), Postives = 86/112 (76.79%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTV DA RL GR+F D  VQ DMK WPF VI     +P + V YKGE K F  EEISSMVL KM+EIAEAYLG T+ NAV+TVPAY NDSQRQATKDAG I+GLNV
Sbjct:   59 VAMNPTNTVLDANRLNGRQFDDGVVQSDMKHWPFNVI-NDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYSNDSQRQATKDAGTISGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP75_ASHGO (Heat shock protein SSB OS=Ashbya gossypii GN=SSB PE=3 SV=3)

HSP 1 Score: 153.68 bits (387), Expect = 2.720e-37
Identity = 78/111 (70.27%), Postives = 88/111 (79.28%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP NTVFDAKRLIGRRF D SVQ DMK WPFKVI      PMI V Y GE K F+ +EIS+MVL KM+EIAEA +G  ++ AV+TVPAYFND+QRQATKDAG IAGLNV
Sbjct:   62 ALNPRNTVFDAKRLIGRRFDDESVQSDMKTWPFKVIDANGS-PMIEVEYLGETKSFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_CERCA (Heat shock protein 70 OS=Ceratitis capitata PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.720e-37
Identity = 78/112 (69.64%), Postives = 88/112 (78.57%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR++ D  +  D+K WPFKV++    KP I V YK E KQFA EEISSMVL KM+E AE  LG T+ +AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   56 VAMNPKNTVFDAKRLIGRKYDDPKIMEDVKHWPFKVVSD-GGKPKISVEYKEENKQFAPEEISSMVLTKMKETAEVILGTTVTDAVITVPAYFNDSQRQATKDAGRIAGLNV 166          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_YEAST (Heat shock protein SSA2 OS=Saccharomyces cerevisiae GN=SSA2 PE=1 SV=3)

HSP 1 Score: 153.295 bits (386), Expect = 3.552e-37
Identity = 80/111 (72.07%), Postives = 89/111 (80.18%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            AMNP NTVFDAKRLIGR F+D  VQGDMK +PFK+I     KP I V +KGE K F  E+ISSMVL KM+E AE+YLGA + +AVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   58 AMNPANTVFDAKRLIGRNFNDPEVQGDMKHFPFKLIDVDG-KPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_BRELC (Heat shock 70 kDa protein OS=Bremia lactucae GN=HSP70 PE=3 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 4.639e-37
Identity = 78/112 (69.64%), Postives = 90/112 (80.36%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMN  NTVFDAK LIGR+FSD  VQ D+K WPFK+ +G     ++ V +KGE K F  EEISSMVLIKMRE+AEA++G  +KNAV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   62 VAMNAHNTVFDAKPLIGRKFSDPIVQADIKHWPFKLTSGWRQAQIV-VQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNV 172          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP75_KLUMA (Heat shock protein SSB OS=Kluyveromyces marxianus GN=SSB PE=3 SV=2)

HSP 1 Score: 151.754 bits (382), Expect = 1.034e-36
Identity = 78/111 (70.27%), Postives = 88/111 (79.28%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP NTVFDAKRLIGRRF + SVQ DMK WPFKVI      P+I V Y GE K F+ +EISSMVL KM+EIAEA +G  ++ AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   62 ALNPKNTVFDAKRLIGRRFDEESVQSDMKTWPFKVIDSNG-APLIEVEYLGETKTFSPQEISSMVLTKMKEIAEAKIGKKVEKAVVTVPAYFNDAQRQATKDAGAIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP75_KLUDE (Heat shock protein SSB OS=Kluyveromyces delphensis GN=SSB PE=3 SV=3)

HSP 1 Score: 151.369 bits (381), Expect = 1.350e-36
Identity = 76/111 (68.47%), Postives = 89/111 (80.18%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP NTVFDAKRLIGRRF + SVQ DMK WPFKV+      P+I V Y GE KQF+ +EISSMVL KM+EIAEA +G  ++ AV+TVPAYFND+QRQATKDAG I+GLNV
Sbjct:   62 ALNPKNTVFDAKRLIGRRFDEESVQNDMKTWPFKVV-DVEGAPVIEVEYLGETKQFSPQEISSMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNV 171          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP76_PIG5.480e-3868.47Heat shock 70 kDa protein 6 OS=Sus scrofa GN=HSPA6... [more]
HSP70_HYDMA1.221e-3770.54Heat shock 70 kDa protein OS=Hydra magnipapillata ... [more]
HSP75_KLULA2.083e-3771.17Heat shock protein SSB OS=Kluyveromyces lactis GN=... [more]
HSP7C_DANRE2.720e-3770.54Heat shock cognate 71 kDa protein OS=Danio rerio G... [more]
HSP75_ASHGO2.720e-3770.27Heat shock protein SSB OS=Ashbya gossypii GN=SSB P... [more]
HSP70_CERCA2.720e-3769.64Heat shock protein 70 OS=Ceratitis capitata PE=2 S... [more]
HSP72_YEAST3.552e-3772.07Heat shock protein SSA2 OS=Saccharomyces cerevisia... [more]
HSP70_BRELC4.639e-3769.64Heat shock 70 kDa protein OS=Bremia lactucae GN=HS... [more]
HSP75_KLUMA1.034e-3670.27Heat shock protein SSB OS=Kluyveromyces marxianus ... [more]
HSP75_KLUDE1.350e-3668.47Heat shock protein SSB OS=Kluyveromyces delphensis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top