FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP75_CANGA (Heat shock protein SSB OS=Candida glabrata GN=SSB1 PE=3 SV=3)

HSP 1 Score: 151.369 bits (381), Expect = 1.350e-36
Identity = 76/111 (68.47%), Postives = 89/111 (80.18%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP NTVFDAKRLIGRRF + SVQ DMK WPFKV+      P+I V Y GE KQF+ +EISSMVL KM+EIAEA +G  ++ AV+TVPAYFND+QRQATKDAG I+GLNV
Sbjct:   62 ALNPKNTVFDAKRLIGRRFDEESVQNDMKTWPFKVVDVDG-APVIEVEYLGENKQFSPQEISSMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_YEAST (Heat shock protein SSA1 OS=Saccharomyces cerevisiae GN=SSA1 PE=1 SV=4)

HSP 1 Score: 151.369 bits (381), Expect = 1.350e-36
Identity = 79/111 (71.17%), Postives = 89/111 (80.18%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            AMNP+NTVFDAKRLIGR F+D  VQ DMK +PFK+I     KP I V +KGE K F  E+ISSMVL KM+E AE+YLGA + +AVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   58 AMNPSNTVFDAKRLIGRNFNDPEVQADMKHFPFKLIDVDG-KPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_PLEWA (Heat shock 70 kDa protein OS=Pleurodeles waltlii GN=HSP70 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.350e-36
Identity = 75/112 (66.96%), Postives = 90/112 (80.36%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            V++NP NTVFDAKRLIGR+F+D  VQ DMK WPFKV++    KP + V YKG+ K F  +E+SSMVLIKM+EIAEAYLG  + NAV+TVP+Y   SQRQATKDAGV+AGLNV
Sbjct:   61 VSLNPQNTVFDAKRLIGRKFNDTVVQADMKHWPFKVVSDEW-KPKVQVEYKGDNKTFFPDEVSSMVLIKMKEIAEAYLGHLVSNAVITVPSYLTASQRQATKDAGVLAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_BLAEM (Heat shock 70 kDa protein OS=Blastocladiella emersonii GN=HSP70 PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.350e-36
Identity = 78/112 (69.64%), Postives = 85/112 (75.89%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGRRF D  VQ DMK W F V+     KP+  V +KGE K F  EE SSM+L KM+E AEAYLG  + +AVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   62 VAMNPHNTVFDAKRLIGRRFDDDVVQADMKHWSFTVV-NKNSKPLFQVEFKGETKTFTPEEFSSMILTKMKETAEAYLGTKVNHAVVTVPAYFNDSQRQATKDAGAIAGLNV 172          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_MIMIV (Heat shock 70 kDa protein homolog OS=Acanthamoeba polyphaga mimivirus GN=HSP70 PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.763e-36
Identity = 74/111 (66.67%), Postives = 90/111 (81.08%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NPTNT+FDAKRLIGR F+D SVQ DMK WPFKVI    +KP   V+Y+ E KQ++ E+ISSM+L KM++ A AY+G  + +AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   60 AINPTNTIFDAKRLIGRDFNDQSVQSDMKYWPFKVI-NVGNKPYFEVSYQNESKQYSPEQISSMILSKMKQTASAYIGKEVTDAVITVPAYFNDSQRQATKDAGRIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_CAEEL (Heat shock 70 kDa protein C OS=Caenorhabditis elegans GN=hsp-3 PE=2 SV=2)

HSP 1 Score: 150.599 bits (379), Expect = 2.302e-36
Identity = 73/112 (65.18%), Postives = 91/112 (81.25%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            + +NP NT+FDAKRLIGR ++D +VQ D+K WPFKVI   ++KP + V    + KQF  EE+S+MVL+KM+EIAE+YLG  +KNAVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   90 LTINPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVI-DKSNKPSVEVKVGSDNKQFTPEEVSAMVLVKMKEIAESYLGKEVKNAVVTVPAYFNDAQRQATKDAGTIAGLNV 200          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_PICAN (Heat shock protein 70 1 OS=Pichia angusta GN=HSA1 PE=1 SV=2)

HSP 1 Score: 149.828 bits (377), Expect = 3.927e-36
Identity = 76/111 (68.47%), Postives = 88/111 (79.28%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            AMNP NTVFDAKRLIGR+F D  VQ D+K +PFKV+     KP I V +KGE K F  EEISSMVL KM+E AE+Y+G  + +AV+TVPAYFNDSQRQATKDAG+IAGLNV
Sbjct:   58 AMNPANTVFDAKRLIGRKFDDPEVQNDIKHFPFKVVE-KGGKPHIQVEFKGETKVFTPEEISSMVLTKMKETAESYMGGKVTDAVITVPAYFNDSQRQATKDAGLIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS7C4_DICDI (Heat shock cognate 70 kDa protein 4 OS=Dictyostelium discoideum GN=DDB_G0293678 PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 3.927e-36
Identity = 75/113 (66.37%), Postives = 89/113 (78.76%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPAD-KPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NT+FD KRL GR++SD+ VQ DMKLWPFKVIA   D KP+I V++KGE K F+ EEISSMVL KM+EI E +LG  + +AV+TVPAYFND QR ATK AG I+ LNV
Sbjct:   57 VAMNPVNTIFDVKRLFGRKYSDSVVQSDMKLWPFKVIANKFDDKPLIQVDFKGETKTFSPEEISSMVLSKMKEIVEQHLGEPVTDAVITVPAYFNDRQRHATKYAGTISNLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP74_YEAST (Heat shock protein SSA4 OS=Saccharomyces cerevisiae GN=SSA4 PE=1 SV=3)

HSP 1 Score: 149.443 bits (376), Expect = 5.129e-36
Identity = 77/111 (69.37%), Postives = 86/111 (77.48%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            AMNP NTVFDAKRLIGR+F D  V  D K +PFKVI     KP++ V YKGE K F  EEISSM+L KM+E AE +LG  +K+AVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   58 AMNPHNTVFDAKRLIGRKFDDPEVTNDAKHYPFKVI-DKGGKPVVQVEYKGETKTFTPEEISSMILTKMKETAENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP77_HUMAN (Putative heat shock 70 kDa protein 7 OS=Homo sapiens GN=HSPA7 PE=5 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 6.699e-36
Identity = 74/111 (66.67%), Postives = 90/111 (81.08%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP NTVFDAKRLIGR+F+D +VQ DMK WPF+V++    KP + V Y+GE+K F  EEISSMVL KM+E AEAYLG  +K+AV+TVP YF++SQRQATKDAG IAGL V
Sbjct:   62 ALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFQVVS-EGGKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVPTYFSNSQRQATKDAGAIAGLKV 171          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP75_CANGA1.350e-3668.47Heat shock protein SSB OS=Candida glabrata GN=SSB1... [more]
HSP71_YEAST1.350e-3671.17Heat shock protein SSA1 OS=Saccharomyces cerevisia... [more]
HSP70_PLEWA1.350e-3666.96Heat shock 70 kDa protein OS=Pleurodeles waltlii G... [more]
HSP70_BLAEM1.350e-3669.64Heat shock 70 kDa protein OS=Blastocladiella emers... [more]
HSP70_MIMIV1.763e-3666.67Heat shock 70 kDa protein homolog OS=Acanthamoeba ... [more]
HSP7C_CAEEL2.302e-3665.18Heat shock 70 kDa protein C OS=Caenorhabditis eleg... [more]
HSP71_PICAN3.927e-3668.47Heat shock protein 70 1 OS=Pichia angusta GN=HSA1 ... [more]
HS7C4_DICDI3.927e-3666.37Heat shock cognate 70 kDa protein 4 OS=Dictyosteli... [more]
HSP74_YEAST5.129e-3669.37Heat shock protein SSA4 OS=Saccharomyces cerevisia... [more]
HSP77_HUMAN6.699e-3666.67Putative heat shock 70 kDa protein 7 OS=Homo sapie... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top