FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: BIP4_TOBAC (Luminal-binding protein 4 OS=Nicotiana tabacum GN=BIP4 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.397e-33
Identity = 76/112 (67.86%), Postives = 87/112 (77.68%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYK-GEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP  TVFD KRLIGR+F D  VQ DMKL P+K++     KP I V  K GE K F+ EEIS+M+L KM+E AEAYLG  IK+AVVTVPAYFND+QRQATKDAGVIAGLNV
Sbjct:   93 AVNPERTVFDVKRLIGRKFDDKEVQRDMKLVPYKIV-NKDGKPYIQVKIKDGETKIFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNV 203          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_ECHMU (78 kDa glucose-regulated protein OS=Echinococcus multilocularis GN=GRP78 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 1.824e-33
Identity = 73/109 (66.97%), Postives = 85/109 (77.98%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+FDAKRLIGR + D  VQGD+K +PFKVI    +KP + V    EEK FA EE+S+MVL KM+EIAEAYLG  + +AVVTVPAYFND+QRQATKDAG IAGL V
Sbjct:   87 NPKNTLFDAKRLIGRDYDDKDVQGDIKRYPFKVI-NKNNKPYMKVQVGSEEKGFAPEEVSAMVLSKMKEIAEAYLGTEVTHAVVTVPAYFNDAQRQATKDAGAIAGLTV 194          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_ECHGR (78 kDa glucose-regulated protein OS=Echinococcus granulosus GN=GRP78 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.383e-33
Identity = 73/109 (66.97%), Postives = 85/109 (77.98%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+FDAKRLIGR + D  VQGD+K +PFKVI    +KP + V    EEK FA EE+S+MVL KM+EIAEAYLG  + +AVVTVPAYFND+QRQATKDAG IAGL V
Sbjct:   87 NPKNTLFDAKRLIGRDYHDKDVQGDIKRYPFKVI-NKNNKPYMKVQVGSEEKGFAPEEVSAMVLSKMKEIAEAYLGTEVTHAVVTVPAYFNDAQRQATKDAGAIAGLTV 194          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_CANGA (78 kDa glucose-regulated protein homolog OS=Candida glabrata GN=KAR2 PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 4.064e-33
Identity = 71/112 (63.39%), Postives = 87/112 (77.68%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            +A NPTNT+FD KRLIG +F+D SVQ D+K  PFKV+     KP++ V  KGE++ F  EEIS M+L KM++IAE YLG  + +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   91 IAANPTNTIFDIKRLIGLKFNDRSVQRDIKHLPFKVVDKDG-KPVVQVKVKGEDRVFTPEEISGMILGKMKQIAEDYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 201          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: BIP2_DICDI (Luminal-binding protein 2 OS=Dictyostelium discoideum GN=bip2 PE=1 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 5.308e-33
Identity = 70/110 (63.64%), Postives = 87/110 (79.09%), Query Frame = 2
Query:    8 MNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            +NP NT+FD KRLIGRRF D  VQ DMKL P+K+++   +KP + V  KGEEK ++ EEIS+M+L +M+EIAEA LG T+ +AVVT PAYFND+QR ATKDAGVIAGL V
Sbjct:   89 LNPENTIFDIKRLIGRRFDDEEVQRDMKLLPYKIVS-KNNKPYVVVKVKGEEKTYSPEEISAMILGRMKEIAEASLGKTVTHAVVTCPAYFNDAQRAATKDAGVIAGLEV 197          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_PARBA (Heat shock 70 kDa protein 1 OS=Paracoccidioides brasiliensis (strain ATCC MYA-826 / Pb01) GN=HSP70-1 PE=1 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 9.054e-33
Identity = 75/112 (66.96%), Postives = 84/112 (75.00%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP  TVF+AKRLIGR+F+D  VQ DMK +PFK I      P I V ++GE K F  E ISSM   K REIAE+YLG T+ NAVVTVPAYFNDSQRQ TKDAG+IAGLNV
Sbjct:   57 VAMNP-QTVFEAKRLIGRKFADPEVQADMKHFPFK-ITDKGGNPKIQVEFRGEGKHFTPEGISSMFRRKKREIAESYLGGTVNNAVVTVPAYFNDSQRQVTKDAGLIAGLNV 166          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_XENLA (78 kDa glucose-regulated protein OS=Xenopus laevis GN=hspa5 PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 9.054e-33
Identity = 74/109 (67.89%), Postives = 85/109 (77.98%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NTVFDAKRLIGR ++D SVQ D+K  PFKVI     KP I V+   + K FA EEIS+MVL+KM+E AEAYLG  + +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   89 NPENTVFDAKRLIGRTWNDPSVQQDIKYLPFKVIEKKT-KPYIEVDIGDQMKTFAPEEISAMVLVKMKETAEAYLGRKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 196          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: BIP2_MAIZE (Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=1 SV=3)

HSP 1 Score: 138.272 bits (347), Expect = 1.183e-32
Identity = 74/112 (66.07%), Postives = 87/112 (77.68%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYK-GEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP  T+FD KRLIGR+F+D  VQ DMKL P+K+I     KP I V  K GE K F+ EEIS+M+L KM++ AEAYLG  I +AVVTVPAYFND+QRQATKDAGVIAGLNV
Sbjct:   89 AVNPERTIFDVKRLIGRKFADKEVQRDMKLVPYKII-NKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNV 199          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: BIP3_MAIZE (Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.544e-32
Identity = 74/112 (66.07%), Postives = 86/112 (76.79%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYK-GEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP  T+FD KRLIGR+F D  VQ DMKL P+K+I     KP I V  K GE K F+ EEIS+M+L KM++ AEAYLG  I +AVVTVPAYFND+QRQATKDAGVIAGLNV
Sbjct:   89 AVNPERTIFDVKRLIGRKFQDKEVQRDMKLVPYKII-NKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNV 199          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: BIP2_ARATH (Luminal-binding protein 2 OS=Arabidopsis thaliana GN=At5g42020 PE=1 SV=2)

HSP 1 Score: 137.887 bits (346), Expect = 1.544e-32
Identity = 74/112 (66.07%), Postives = 86/112 (76.79%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYK-GEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP  TVFD KRLIGR+F D  VQ D KL P++++     KP I V  K GE K F+ EEIS+M+L KM+E AEAYLG  IK+AVVTVPAYFND+QRQATKDAGVIAGLNV
Sbjct:   91 AVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIV-NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNV 201          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
BIP4_TOBAC1.397e-3367.86Luminal-binding protein 4 OS=Nicotiana tabacum GN=... [more]
GRP78_ECHMU1.824e-3366.9778 kDa glucose-regulated protein OS=Echinococcus m... [more]
GRP78_ECHGR2.383e-3366.9778 kDa glucose-regulated protein OS=Echinococcus g... [more]
GRP78_CANGA4.064e-3363.3978 kDa glucose-regulated protein homolog OS=Candid... [more]
BIP2_DICDI5.308e-3363.64Luminal-binding protein 2 OS=Dictyostelium discoid... [more]
HSP71_PARBA9.054e-3366.96Heat shock 70 kDa protein 1 OS=Paracoccidioides br... [more]
GRP78_XENLA9.054e-3367.8978 kDa glucose-regulated protein OS=Xenopus laevis... [more]
BIP2_MAIZE1.183e-3266.07Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=... [more]
BIP3_MAIZE1.544e-3266.07Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=... [more]
BIP2_ARATH1.544e-3266.07Luminal-binding protein 2 OS=Arabidopsis thaliana ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top