FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_RHIE6 (Chaperone protein dnaK OS=Rhizobium etli (strain CIAT 652) GN=dnaK PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 2.821e-26
Identity = 59/109 (54.13%), Postives = 77/109 (70.64%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NPTNT+F  KRLIGRR+ D +V+ D  L PF ++ G      +  N KG    ++  +IS+M+L KM+E AE+YLG  ++ AV+TVPAYFND+QRQATKDAG IAGL V
Sbjct:   61 NPTNTLFAVKRLIGRRYEDPTVEKDKHLVPFSIVKGDNGDAWVEANGKG----YSPAQISAMILQKMKETAESYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_RHOCA (Chaperone protein dnaK OS=Rhodobacter capsulatus GN=dnaK PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 3.685e-26
Identity = 61/109 (55.96%), Postives = 80/109 (73.39%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NPTNTVF  KRLIGRR +DA V+ D KL P+ ++ G      + V  +GE+  F+  ++S+++L KM+E AE+YLG T+  AV+TVPAYFND+QRQATKDAG IAGL V
Sbjct:   60 NPTNTVFAVKRLIGRRTTDAEVEKDKKLVPYNIVDGGNGDAWVEV--RGEK--FSPAQVSAVILQKMKETAESYLGETVTQAVITVPAYFNDAQRQATKDAGKIAGLEV 164          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7F_CAEEL (Heat shock 70 kDa protein F, mitochondrial OS=Caenorhabditis elegans GN=hsp-6 PE=1 SV=2)

HSP 1 Score: 116.316 bits (290), Expect = 4.812e-26
Identity = 57/109 (52.29%), Postives = 77/109 (70.64%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            N  NT+F  KRLIGRR+ D  VQ D+K+ P+K++        +    + + K ++  ++ + VL+KM+E AE+YLG T+ NAVVTVPAYFNDSQRQATKDAG I+GLNV
Sbjct:   90 NSANTLFATKRLIGRRYEDPEVQKDLKVVPYKIVKASNGDAWV----EAQGKVYSPSQVGAFVLMKMKETAESYLGTTVNNAVVTVPAYFNDSQRQATKDAGQISGLNV 194          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP77_YEAST (Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae GN=SSC1 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 4.812e-26
Identity = 61/110 (55.45%), Postives = 75/110 (68.18%), Query Frame = 2
Query:    8 MNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            +NP NT+F  KRLIGRRF DA VQ D+K  P+K++        +    +   + ++  +I   VL KM+E AEAYLG  +KNAVVTVPAYFNDSQRQATKDAG I GLNV
Sbjct:   88 VNPENTLFATKRLIGRRFEDAEVQRDIKQVPYKIVKHSNGDAWV----EARGQTYSPAQIGGFVLNKMKETAEAYLGKPVKNAVVTVPAYFNDSQRQATKDAGQIVGLNV 193          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_RHILW (Chaperone protein dnaK OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaK PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 4.812e-26
Identity = 59/109 (54.13%), Postives = 77/109 (70.64%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NPTNT+F  KRLIGRR+ D +V+ D  L PF ++ G      +  N KG    ++  +IS+M+L KM+E AE+YLG  ++ AV+TVPAYFND+QRQATKDAG IAGL V
Sbjct:   61 NPTNTLFAVKRLIGRRYEDPTVEKDKHLVPFTIVKGDNGDAWVEANGKG----YSPAQISAMILQKMKETAESYLGEKVEKAVITVPAYFNDAQRQATKDAGRIAGLEV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_RHIL3 (Chaperone protein dnaK OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaK PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 4.812e-26
Identity = 59/109 (54.13%), Postives = 77/109 (70.64%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NPTNT+F  KRLIGRR+ D +V+ D  L PF ++ G      +  N KG    ++  +IS+M+L KM+E AE+YLG  ++ AV+TVPAYFND+QRQATKDAG IAGL V
Sbjct:   61 NPTNTLFAVKRLIGRRYEDPTVEKDKHLVPFTIVKGDNGDAWVEANGKG----YSPAQISAMILQKMKETAESYLGEKVEKAVITVPAYFNDAQRQATKDAGRIAGLEV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_SACD2 (Chaperone protein dnaK OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dnaK PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 6.285e-26
Identity = 64/109 (58.72%), Postives = 80/109 (73.39%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+F  KRLIGR+F+D  VQ D+ + P+K+IA  AD     V  KG++K  A  +IS+ VL KM++ AE YLG T+  AV+TVPAYFNDSQRQATKDAG IAGL+V
Sbjct:   61 NPQNTLFAVKRLIGRKFTDDVVQKDISMVPYKIIA--ADNGDAWVEVKGDKK--APPQISAEVLKKMKKTAEDYLGETVTEAVITVPAYFNDSQRQATKDAGKIAGLDV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK1_COLP3 (Chaperone protein dnaK 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dnaK1 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 6.285e-26
Identity = 62/109 (56.88%), Postives = 79/109 (72.48%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            N TNT+F  KRLIGR+F D  VQ D+KL P+K++   AD     V   G  K  + +E+S+ +L K+++ AEAYLG T+ +AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   60 NSTNTLFAIKRLIGRKFDDKEVQKDIKLAPYKIVK--ADNGDAWVEVDG--KALSPQEVSAQILRKLKKDAEAYLGETVTDAVITVPAYFNDSQRQATKDAGKIAGLNV 164          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_RHOS1 (Chaperone protein dnaK OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dnaK PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 8.208e-26
Identity = 61/109 (55.96%), Postives = 78/109 (71.56%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP+NTVF  KRLIGRR  DA V+ D KL P+ ++ G      + V  +GE+  ++  +IS+ +L KM+E AEAYLG T+  AV+TVPAYFND+QRQATKDAG IAGL V
Sbjct:   60 NPSNTVFAVKRLIGRRVGDAEVEKDKKLVPYSIVNGGNGDAWVEV--RGEK--YSPSQISAFILQKMKETAEAYLGETVTQAVITVPAYFNDAQRQATKDAGKIAGLEV 164          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_GEOSL (Chaperone protein dnaK OS=Geobacter sulfurreducens GN=dnaK PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 8.208e-26
Identity = 62/109 (56.88%), Postives = 79/109 (72.48%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+F  KRLIGR++    V+ D+ + PFK++   AD     V  +G  K ++A EIS+MVL KM++ AE YLG T+ +AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   61 NPENTLFAIKRLIGRKYDTEEVRKDISISPFKIVK--ADNGDAWVEARG--KMYSAPEISAMVLQKMKQTAEDYLGETVTDAVITVPAYFNDSQRQATKDAGKIAGLNV 165          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_RHIE62.821e-2654.13Chaperone protein dnaK OS=Rhizobium etli (strain C... [more]
DNAK_RHOCA3.685e-2655.96Chaperone protein dnaK OS=Rhodobacter capsulatus G... [more]
HSP7F_CAEEL4.812e-2652.29Heat shock 70 kDa protein F, mitochondrial OS=Caen... [more]
HSP77_YEAST4.812e-2655.45Heat shock protein SSC1, mitochondrial OS=Saccharo... [more]
DNAK_RHILW4.812e-2654.13Chaperone protein dnaK OS=Rhizobium leguminosarum ... [more]
DNAK_RHIL34.812e-2654.13Chaperone protein dnaK OS=Rhizobium leguminosarum ... [more]
DNAK_SACD26.285e-2658.72Chaperone protein dnaK OS=Saccharophagus degradans... [more]
DNAK1_COLP36.285e-2656.88Chaperone protein dnaK 1 OS=Colwellia psychrerythr... [more]
DNAK_RHOS18.208e-2655.96Chaperone protein dnaK OS=Rhodobacter sphaeroides ... [more]
DNAK_GEOSL8.208e-2656.88Chaperone protein dnaK OS=Geobacter sulfurreducens... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top