FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_ECO57 (Chaperone protein dnaK OS=Escherichia coli O157:H7 GN=dnaK PE=2 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 4.074e-25
Identity = 63/109 (57.80%), Postives = 76/109 (69.72%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+F  KRLIGRRF D  VQ D+ + PFK+IA  AD     V  KG++   A  +IS+ VL KM++ AE YLG  +  AV+TVPAYFND+QRQATKDAG IAGL V
Sbjct:   61 NPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIA--ADNGDAWVEVKGQK--MAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_ECO24 (Chaperone protein dnaK OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaK PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.074e-25
Identity = 63/109 (57.80%), Postives = 76/109 (69.72%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+F  KRLIGRRF D  VQ D+ + PFK+IA  AD     V  KG++   A  +IS+ VL KM++ AE YLG  +  AV+TVPAYFND+QRQATKDAG IAGL V
Sbjct:   61 NPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIA--ADNGDAWVEVKGQK--MAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_DESAA (Chaperone protein dnaK OS=Desulfatibacillum alkenivorans (strain AK-01) GN=dnaK PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.074e-25
Identity = 57/109 (52.29%), Postives = 78/109 (71.56%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NTVF  KRLIGR+F+   V+ DM + P++++ G      I +    + K+++ +EISS +L  +++ AE YLG T+ +AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   61 NPQNTVFAVKRLIGRKFASQQVKDDMNVLPYQIVDGDNGDAYIEL----QGKKYSPQEISSFILAYIKKAAEEYLGETVTDAVITVPAYFNDSQRQATKDAGKIAGLNV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_ACIAD (Chaperone protein dnaK OS=Acinetobacter sp. (strain ADP1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.074e-25
Identity = 58/109 (53.21%), Postives = 78/109 (71.56%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+F  KRLIGRR+ D +VQ D+ L P+K+I        + VN    +K+ A +++S+ +L KM++ AE YLG T+  AV+TVPAYFND+QRQATKDAG IAGL+V
Sbjct:   60 NPKNTLFAIKRLIGRRYEDQAVQKDIGLVPYKIIKADNGDAWVEVN----DKKLAPQQVSAEILKKMKKTAEDYLGETVTEAVITVPAYFNDAQRQATKDAGRIAGLDV 164          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7M_EMENI (Heat shock 70 kDa protein OS=Emericella nidulans GN=AN6010 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 5.320e-25
Identity = 62/110 (56.36%), Postives = 77/110 (70.00%), Query Frame = 2
Query:    8 MNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            +NP NT+F  KRLIGR+F+DA VQ D+K  P+K++          V  +GE+  ++  +I   VL KM+E AE YL   +KNAVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   99 VNPENTLFATKRLIGRKFTDAEVQRDIKEVPYKIVQHTNGDAW--VEARGEK--YSPAQIGGFVLGKMKETAENYLSKPVKNAVVTVPAYFNDSQRQATKDAGQIAGLNV 204          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_RUTMC (Chaperone protein dnaK OS=Ruthia magnifica subsp. Calyptogena magnifica GN=dnaK PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 5.320e-25
Identity = 62/109 (56.88%), Postives = 77/109 (70.64%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT++  KRLIGRRF + +VQ D+ L P+K++    D     V  KG  K+ AA EIS+ V+ KM++ AE YLG  +  AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   62 NPENTLYAIKRLIGRRFDEDAVQKDINLVPYKIVK--VDNGDAWVEVKG--KKMAAPEISAKVIGKMKKTAEDYLGEEVTEAVITVPAYFNDSQRQATKDAGKIAGLNV 166          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_GEOSF (Chaperone protein dnaK OS=Geobacter sp. (strain FRC-32) GN=dnaK PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 5.320e-25
Identity = 60/109 (55.05%), Postives = 80/109 (73.39%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+F  KRLIGR+F   +V+ D+ + PFK++   AD     V  +G++  ++  EIS+MVL KM++ AE YLG T+ +AV+TVPAYF+DSQRQATKDAG IAGLNV
Sbjct:   61 NPENTLFAIKRLIGRKFESEAVKKDIAISPFKIVK--ADNADAWVEVRGQK--YSPPEISAMVLQKMKKTAEDYLGETVTDAVITVPAYFDDSQRQATKDAGKIAGLNV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_GEOMG (Chaperone protein dnaK OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=dnaK PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 5.320e-25
Identity = 60/109 (55.05%), Postives = 79/109 (72.48%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+F  KRLIGR+F    V+ D+ + PFK++   AD     V+ +G  K ++  E+S++VL KM++ AE YLG T+ +AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   61 NPENTLFAIKRLIGRKFDTDEVRKDISISPFKIVK--ADNGDAWVDVRG--KMYSPPEVSAIVLQKMKKTAEDYLGETVTDAVITVPAYFNDSQRQATKDAGKIAGLNV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_ERWT9 (Chaperone protein dnaK OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dnaK PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 5.320e-25
Identity = 61/109 (55.96%), Postives = 78/109 (71.56%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+F  KRLIGRRF D  VQ D+K+ PFK++   AD     ++ KG+  + A  +IS+ VL KM++ AE YLG  +  AV+TVPAYFND+QRQATKDAG IAGL+V
Sbjct:   61 NPQNTLFAIKRLIGRRFQDEEVQRDIKIMPFKIVG--ADNGDAWLDVKGQ--RVAPPQISAEVLKKMKKTAEDYLGEAVTEAVITVPAYFNDAQRQATKDAGRIAGLDV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_DESOH (Chaperone protein dnaK OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=dnaK PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 5.320e-25
Identity = 61/110 (55.45%), Postives = 79/110 (71.82%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVI-AGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NTVF  KRLIGR+F  A VQ D+K+ P+K+  AG  D   + +N +  +KQ++  EISS +L  ++  AE YLG  + +AV+TVPAYF+DSQRQATKDAG IAGLNV
Sbjct:   61 NPENTVFGVKRLIGRKFDSAEVQHDIKVLPYKIEKAGNGD---LRINLR--DKQYSPAEISSFILADIKHTAEEYLGEKVTDAVITVPAYFSDSQRQATKDAGKIAGLNV 165          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_ECO574.074e-2557.80Chaperone protein dnaK OS=Escherichia coli O157:H7... [more]
DNAK_ECO244.074e-2557.80Chaperone protein dnaK OS=Escherichia coli O139:H2... [more]
DNAK_DESAA4.074e-2552.29Chaperone protein dnaK OS=Desulfatibacillum alkeni... [more]
DNAK_ACIAD4.074e-2553.21Chaperone protein dnaK OS=Acinetobacter sp. (strai... [more]
HSP7M_EMENI5.320e-2556.36Heat shock 70 kDa protein OS=Emericella nidulans G... [more]
DNAK_RUTMC5.320e-2556.88Chaperone protein dnaK OS=Ruthia magnifica subsp. ... [more]
DNAK_GEOSF5.320e-2555.05Chaperone protein dnaK OS=Geobacter sp. (strain FR... [more]
DNAK_GEOMG5.320e-2555.05Chaperone protein dnaK OS=Geobacter metallireducen... [more]
DNAK_ERWT95.320e-2555.96Chaperone protein dnaK OS=Erwinia tasmaniensis (st... [more]
DNAK_DESOH5.320e-2555.45Chaperone protein dnaK OS=Desulfococcus oleovorans... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top