FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS71A_MOUSE (Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hspa1a PE=1 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 2.377e-41
Identity = 84/112 (75.00%), Postives = 93/112 (83.04%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA+NP NTVFDAKRLIGR+F DA VQ DMK WPF+V+    DKP + VNYKGE + F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   59 VALNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVV-NDGDKPKVQVNYKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_CHICK (Heat shock cognate 71 kDa protein OS=Gallus gallus GN=HSPA8 PE=1 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 5.296e-41
Identity = 85/112 (75.89%), Postives = 91/112 (81.25%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGRRF D+ VQ DMK WPF V+   A +P + V YKGE K F  EEISSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQ TKDAG IAGLNV
Sbjct:   59 VAMNPTNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVV-NDAGRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQGTKDAGTIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP74_TRYBB (Heat shock 70 kDa protein 4 OS=Trypanosoma brucei brucei PE=2 SV=2)

HSP 1 Score: 166.007 bits (419), Expect = 5.296e-41
Identity = 82/112 (73.21%), Postives = 93/112 (83.04%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGR+FSD+ VQ DMK WPFKV+    DKP+I V ++GE K F  EEISSMVL+KM+E+AE+YLG  +  AVVTVPAYFNDSQRQATKDAG IAGL V
Sbjct:   59 VAMNPTNTVFDAKRLIGRKFSDSVVQSDMKHWPFKVVTKGDDKPVIQVQFRGETKTFNPEEISSMVLLKMKEVAESYLGKQVAKAVVTVPAYFNDSQRQATKDAGTIAGLEV 170          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_ORYLA (Heat shock 70 kDa protein 1 OS=Oryzias latipes PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 5.296e-41
Identity = 84/112 (75.00%), Postives = 94/112 (83.93%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA+NP+NTVFDAKRLIGRRF +  VQ DMK WPFKV++    KP I V+YKGE K F  EEISSMVL+KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   61 VALNPSNTVFDAKRLIGRRFDEPVVQADMKHWPFKVVS-EGGKPKIQVDYKGENKTFFPEEISSMVLVKMKEIAEAYLGHKVSNAVITVPAYFNDSQRQATKDAGVIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_PYRSA (Heat shock 70 kDa protein OS=Pyrenomonas salina GN=HSP70 PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 5.296e-41
Identity = 83/112 (74.11%), Postives = 93/112 (83.04%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGRRF D +VQ D+K +PFKVI    DKP + V YKGE K FA EEISSMVL+KM+EIAE++LG  +KNAV+TVPAYFNDSQRQATKDAG I GLNV
Sbjct:   62 VAMNPDNTVFDAKRLIGRRFQDPAVQEDVKPFPFKVICKDGDKPAVEVKYKGETKIFAPEEISSMVLLKMKEIAESFLGKEVKNAVITVPAYFNDSQRQATKDAGAITGLNV 173          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_ICTPU (Heat shock cognate 71 kDa protein OS=Ictalurus punctatus GN=hsc70 PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 6.917e-41
Identity = 83/112 (74.11%), Postives = 93/112 (83.04%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNT+FDAKRLIGRRF D+ VQ DMK WPFKVI+    +P + V YKGE K F  EEISSMVL+KM+EIAEAYLG +I NAV+TVPAYFNDSQRQ TKDAG I+GLNV
Sbjct:   59 VAMNPTNTIFDAKRLIGRRFEDSVVQADMKHWPFKVISD-GGRPRLEVEYKGEAKNFYPEEISSMVLVKMKEIAEAYLGKSINNAVITVPAYFNDSQRQRTKDAGTISGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7A_DROME (Heat shock 70 kDa protein cognate 1 OS=Drosophila melanogaster GN=Hsc70-1 PE=1 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 6.917e-41
Identity = 85/112 (75.89%), Postives = 91/112 (81.25%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NT+FDAKRLIGRRF DA+VQ DMK WPF+V A    KP I V YKGE K F  EE+SSMVL KMRE AEAYLG T+ +AVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   59 VAMNPNNTIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENG-KPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLGGTVTDAVVTVPAYFNDSQRQATKDAGAIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP74_ANOAL (Heat shock protein 70 B2 OS=Anopheles albimanus GN=HSP70B2 PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 9.033e-41
Identity = 83/112 (74.11%), Postives = 91/112 (81.25%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGR+F D  +Q DMK WPF V+     KP I V +KGE K FA EEISSMVL KM+E AEAYLG ++KNAV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   57 VAMNPTNTVFDAKRLIGRKFDDPKIQADMKHWPFTVV-NDGGKPKIRVEFKGERKTFAPEEISSMVLTKMKETAEAYLGQSVKNAVITVPAYFNDSQRQATKDAGAIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_ANOAL (Heat shock protein 70 A2 OS=Anopheles albimanus GN=HSP70A2 PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 9.033e-41
Identity = 83/112 (74.11%), Postives = 91/112 (81.25%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGR+F D  +Q DMK WPF V+     KP I V +KGE K FA EEISSMVL KM+E AEAYLG ++KNAV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   57 VAMNPTNTVFDAKRLIGRKFDDPKIQADMKHWPFTVV-NDCGKPKIRVEFKGERKTFAPEEISSMVLTKMKETAEAYLGQSVKNAVITVPAYFNDSQRQATKDAGAIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_RAT (Heat shock 70 kDa protein 1A/1B OS=Rattus norvegicus GN=Hspa1a PE=2 SV=2)

HSP 1 Score: 165.236 bits (417), Expect = 9.033e-41
Identity = 83/112 (74.11%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+V+    DKP + VNYKGE + F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   59 VALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVV-NDGDKPKVQVNYKGENRSFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 169          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HS71A_MOUSE2.377e-4175.00Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hs... [more]
HSP7C_CHICK5.296e-4175.89Heat shock cognate 71 kDa protein OS=Gallus gallus... [more]
HSP74_TRYBB5.296e-4173.21Heat shock 70 kDa protein 4 OS=Trypanosoma brucei ... [more]
HSP71_ORYLA5.296e-4175.00Heat shock 70 kDa protein 1 OS=Oryzias latipes PE=... [more]
HSP70_PYRSA5.296e-4174.11Heat shock 70 kDa protein OS=Pyrenomonas salina GN... [more]
HSP7C_ICTPU6.917e-4174.11Heat shock cognate 71 kDa protein OS=Ictalurus pun... [more]
HSP7A_DROME6.917e-4175.89Heat shock 70 kDa protein cognate 1 OS=Drosophila ... [more]
HSP74_ANOAL9.033e-4174.11Heat shock protein 70 B2 OS=Anopheles albimanus GN... [more]
HSP72_ANOAL9.033e-4174.11Heat shock protein 70 A2 OS=Anopheles albimanus GN... [more]
HSP71_RAT9.033e-4174.11Heat shock 70 kDa protein 1A/1B OS=Rattus norvegic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top