FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_RHOBA (Chaperone protein dnaK OS=Rhodopirellula baltica GN=dnaK PE=2 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 1.892e-22
Identity = 55/109 (50.46%), Postives = 74/109 (67.89%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP  TV+ AKR +GRR ++  VQ + K+ P+ +  GP D   I V     + ++  +EIS+ VL K++E AE+YLG  +  AV+TVPAYFND+QRQATKDAG IAGL V
Sbjct:   64 NPKRTVYSAKRFMGRRHNE--VQSEEKMVPYGITGGPGDYVKIQVG----DSEYTPQEISAKVLRKLKESAESYLGHKVNKAVITVPAYFNDAQRQATKDAGQIAGLEV 166          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_PSEU2 (Chaperone protein dnaK OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dnaK PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.892e-22
Identity = 54/109 (49.54%), Postives = 75/109 (68.81%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT++  KRLIGR+F +  VQ D+++ P+K++        + VN     ++ A  +IS+ +L KM++ AE YLG  +  AV+TVPAYFNDSQRQATKDAG IAGL+V
Sbjct:   61 NPHNTLYAVKRLIGRKFEEDVVQKDIQMVPYKIVKADNGDAWVEVN----GQKMAPPQISAEILKKMKKTAEDYLGEAVTEAVITVPAYFNDSQRQATKDAGRIAGLDV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_PSE14 (Chaperone protein dnaK OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=dnaK PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.892e-22
Identity = 54/109 (49.54%), Postives = 75/109 (68.81%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT++  KRLIGR+F +  VQ D+++ P+K++        + VN     ++ A  +IS+ +L KM++ AE YLG  +  AV+TVPAYFNDSQRQATKDAG IAGL+V
Sbjct:   61 NPHNTLYAVKRLIGRKFEEDVVQKDIQMVPYKIVKADNGDAWVEVN----GQKMAPPQISAEILKKMKKTAEDYLGEAVTEAVITVPAYFNDSQRQATKDAGRIAGLDV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_BURCE (Chaperone protein dnaK OS=Burkholderia cepacia GN=dnaK PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.892e-22
Identity = 59/109 (54.13%), Postives = 72/109 (66.06%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+F  KRLIGRRF +  VQ D+ L P+ +I   AD     V   GE K  A  ++S+  + KM++ AE YLG  +  AV+TVPAYFNDSQRQATKDAG IAGL V
Sbjct:   61 NPKNTLFAVKRLIGRRFEEKEVQKDIGLMPYSIIK--ADNGDAWVEGHGE-KLMAPPQVSAEAVRKMKKTAEDYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGLEV 166          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_XANC5 (Chaperone protein dnaK OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dnaK PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.471e-22
Identity = 55/109 (50.46%), Postives = 74/109 (67.89%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT +  KRLIGR+F+D  VQ D+   P+ ++A       +  +   + K+ A +EIS+ VL KM++ AE +LG  +  AV+TVPAYFNDSQRQATKDAG IAGL+V
Sbjct:   61 NPKNTFYAVKRLIGRKFTDGEVQKDISHVPYGILAHDNGDAWVQTS---DAKRMAPQEISARVLEKMKKTAEDFLGEKVTEAVITVPAYFNDSQRQATKDAGRIAGLDV 166          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_RALEH (Chaperone protein dnaK OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaK PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.471e-22
Identity = 53/109 (48.62%), Postives = 73/109 (66.97%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT++  KRLIGR+F +  VQ D+ L P+ ++        + V     +++ A  ++S+ VL KM++ AE YLG  +  AV+TVPAYFNDSQRQATKDAG IAGL+V
Sbjct:   61 NPRNTLYAVKRLIGRKFEEKEVQKDIGLMPYSIVKADNGDAWVSVR----DQKLAPPQVSAEVLRKMKKTAEDYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGLDV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_OLICO (Chaperone protein dnaK OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=dnaK PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.471e-22
Identity = 53/109 (48.62%), Postives = 72/109 (66.06%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP  T+F  KRLIGRR+ D +V  D  L P+K++        +    + + K ++  +IS+ +L KM+E AEA+LG  +  AV+TVPAYFND+QRQATKDAG IAGL V
Sbjct:   61 NPEKTIFAVKRLIGRRYDDPTVAKDKDLVPYKIVKASNGDAWV----EADGKIYSPSQISAFILQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQATKDAGKIAGLEV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_METPP (Chaperone protein dnaK OS=Methylibium petroleiphilum (strain PM1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.471e-22
Identity = 56/109 (51.38%), Postives = 76/109 (69.72%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT++  KRLIGR+F++  VQ D+ L P+ + A  A+     V  +G +   A  ++S+ VL KM++ AE YLG T+  AV+TVPAYFND+QRQATKDAG IAGL+V
Sbjct:   61 NPRNTLYAVKRLIGRKFTEKEVQKDIDLMPYTIAA--AENGDAWVEVRGNK--LAPPQVSAEVLRKMKKTAEDYLGETVTEAVITVPAYFNDAQRQATKDAGRIAGLDV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_DIAST (Chaperone protein dnaK OS=Diaphorobacter sp. (strain TPSY) GN=dnaK PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.471e-22
Identity = 57/109 (52.29%), Postives = 75/109 (68.81%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT++ AKRLIGR+F +  VQ D+ L PF +    AD     V  +G++   A  +IS+ VL KM++ AE +LG  +  AV+TVPAYFND+QRQATKDAG IAGL+V
Sbjct:   61 NPKNTIYAAKRLIGRKFEEKEVQKDIDLMPFTITR--ADNGDAWVEVRGQK--LAPPQISAEVLRKMKKTAEDFLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLDV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_DELAS (Chaperone protein dnaK OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.471e-22
Identity = 57/109 (52.29%), Postives = 74/109 (67.89%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT++ AKRLIGR+F +  VQ D+ L P+ +    AD     V  +G++   A  +IS+ VL KM++ AE YLG  +  AV+TVPAYFND+QRQATKDAG IAGL V
Sbjct:   61 NPRNTIYAAKRLIGRKFDEKEVQKDIDLMPYTI--SRADNGDAWVEVRGQK--LAPPQISAEVLRKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEV 165          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_RHOBA1.892e-2250.46Chaperone protein dnaK OS=Rhodopirellula baltica G... [more]
DNAK_PSEU21.892e-2249.54Chaperone protein dnaK OS=Pseudomonas syringae pv.... [more]
DNAK_PSE141.892e-2249.54Chaperone protein dnaK OS=Pseudomonas syringae pv.... [more]
DNAK_BURCE1.892e-2254.13Chaperone protein dnaK OS=Burkholderia cepacia GN=... [more]
DNAK_XANC52.471e-2250.46Chaperone protein dnaK OS=Xanthomonas campestris p... [more]
DNAK_RALEH2.471e-2248.62Chaperone protein dnaK OS=Ralstonia eutropha (stra... [more]
DNAK_OLICO2.471e-2248.62Chaperone protein dnaK OS=Oligotropha carboxidovor... [more]
DNAK_METPP2.471e-2251.38Chaperone protein dnaK OS=Methylibium petroleiphil... [more]
DNAK_DIAST2.471e-2252.29Chaperone protein dnaK OS=Diaphorobacter sp. (stra... [more]
DNAK_DELAS2.471e-2252.29Chaperone protein dnaK OS=Delftia acidovorans (str... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top