FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_CANFA (Heat shock 70 kDa protein 1 OS=Canis familiaris GN=HSPA1 PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 2.628e-40
Identity = 83/112 (74.11%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+V+    DKP + V+YKGE K F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   59 VALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVV-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_SCHMA (Heat shock 70 kDa protein homolog OS=Schistosoma mansoni PE=2 SV=2)

HSP 1 Score: 163.696 bits (413), Expect = 2.628e-40
Identity = 84/112 (75.00%), Postives = 93/112 (83.04%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGRRF D SVQ DMK WPF+V      K  I V YKGE+K F+AEEISSMVL KM+E+AE+YLG T+ +AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   57 VAMNPTNTVFDAKRLIGRRFDDPSVQSDMKHWPFEVTQ-VGGKLKICVEYKGEKKMFSAEEISSMVLTKMKEVAESYLGRTVSDAVITVPAYFNDSQRQATKDAGAIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_HUMAN (Heat shock-related 70 kDa protein 2 OS=Homo sapiens GN=HSPA2 PE=1 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 3.433e-40
Identity = 81/112 (72.32%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNT+FDAKRLIGR+F DA+VQ DMK WPF+V++    KP + V YKGE K F  EEISSMVL KM+EIAEAYLG  + +AV+TVPAYFNDSQRQATKDAG I GLNV
Sbjct:   60 VAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVS-EGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNV 170          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_CAPHI (Heat shock-related 70 kDa protein 2 OS=Capra hircus GN=HSPA2 PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 3.433e-40
Identity = 81/112 (72.32%), Postives = 93/112 (83.04%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNT+FDAKRLIGR+F DA+VQ DMK WPF+V++    KP + V YKGE K F  EEISSMVL KM+EIAEAYLG  +++AV+TVPAYFNDSQRQATKDAG I GLNV
Sbjct:   60 VAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVS-EGGKPKVQVEYKGEIKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNV 170          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_BOVIN (Heat shock-related 70 kDa protein 2 OS=Bos taurus GN=HSPA2 PE=2 SV=2)

HSP 1 Score: 163.31 bits (412), Expect = 3.433e-40
Identity = 81/112 (72.32%), Postives = 93/112 (83.04%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNT+FDAKRLIGR+F DA+VQ DMK WPF+V++    KP + V YKGE K F  EEISSMVL KM+EIAEAYLG  +++AV+TVPAYFNDSQRQATKDAG I GLNV
Sbjct:   60 VAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVS-EGGKPKVQVEYKGEIKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNV 170          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7D_DROME (Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster GN=Hsc70-4 PE=1 SV=3)

HSP 1 Score: 162.925 bits (411), Expect = 4.483e-40
Identity = 82/112 (73.21%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPT T+FDAKRLIGR+F DA+VQ DMK WPF+V++    KP I V YK E+K F  EEISSMVL KM+E AEAYLG T+ NAV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   59 VAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADG-KPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_SCHPO (Probable heat shock protein ssa2 OS=Schizosaccharomyces pombe GN=ssa2 PE=1 SV=3)

HSP 1 Score: 162.925 bits (411), Expect = 4.483e-40
Identity = 83/112 (74.11%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NT+FDAKRLIGR+F D  VQ DMK WPFKVI+    KP++ V YKGE K F  EEISSMVL+KMRE AEAYLG  + +AVVTVPAYFNDSQRQATKDAG+IAGLNV
Sbjct:   57 VAMNPHNTIFDAKRLIGRKFDDPEVQSDMKHWPFKVISKDG-KPVLQVEYKGETKTFTPEEISSMVLMKMRETAEAYLGGKVTDAVVTVPAYFNDSQRQATKDAGLIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_THEPA (Heat shock 70 kDa protein OS=Theileria parva GN=TP02_0148 PE=2 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 4.483e-40
Identity = 80/111 (72.07%), Postives = 92/111 (82.88%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A NP NT+FDAKRLIGR+F D +VQ DMK WPFKV  GP  KP I V ++GE+K F AEEISSMVL KM+EIAEA+LG ++K+ V+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   59 ARNPENTIFDAKRLIGRKFDDRTVQEDMKHWPFKVTNGPNGKPNIEVTFQGEKKTFHAEEISSMVLTKMKEIAEAFLGKSVKDVVITVPAYFNDSQRQATKDAGTIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_AJECA (Heat shock 70 kDa protein OS=Ajellomyces capsulata GN=HSP70 PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 4.483e-40
Identity = 84/112 (75.00%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F+D  VQ DMK +PFK I     KP+I V +KGE K+F  EEISSMVL KMRE AEAYLG T+ NAVVTVPAYFNDSQRQATKDAG+IAGLNV
Sbjct:   57 VAMNPANTVFDAKRLIGRKFADPEVQADMKHFPFK-ITDKGGKPVIQVEFKGETKEFTPEEISSMVLTKMRETAEAYLGGTVNNAVVTVPAYFNDSQRQATKDAGLIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7B_DROME (Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 5.855e-40
Identity = 84/112 (75.00%), Postives = 91/112 (81.25%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMN  NTVFDAKRLIGR+F D  +Q D+KLWPFKVI     KP I V +KGE K+FA EEISSMVL KMREIAE YLG  +K+AVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   59 VAMNAKNTVFDAKRLIGRKFDDKKIQEDLKLWPFKVI-NEKGKPKIEVEFKGERKRFAPEEISSMVLTKMREIAEVYLGGKVKDAVVTVPAYFNDSQRQATKDAGSIAGLNV 169          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP71_CANFA2.628e-4074.11Heat shock 70 kDa protein 1 OS=Canis familiaris GN... [more]
HSP70_SCHMA2.628e-4075.00Heat shock 70 kDa protein homolog OS=Schistosoma m... [more]
HSP72_HUMAN3.433e-4072.32Heat shock-related 70 kDa protein 2 OS=Homo sapien... [more]
HSP72_CAPHI3.433e-4072.32Heat shock-related 70 kDa protein 2 OS=Capra hircu... [more]
HSP72_BOVIN3.433e-4072.32Heat shock-related 70 kDa protein 2 OS=Bos taurus ... [more]
HSP7D_DROME4.483e-4073.21Heat shock 70 kDa protein cognate 4 OS=Drosophila ... [more]
HSP72_SCHPO4.483e-4074.11Probable heat shock protein ssa2 OS=Schizosaccharo... [more]
HSP70_THEPA4.483e-4072.07Heat shock 70 kDa protein OS=Theileria parva GN=TP... [more]
HSP70_AJECA4.483e-4075.00Heat shock 70 kDa protein OS=Ajellomyces capsulata... [more]
HSP7B_DROME5.855e-4075.00Heat shock 70 kDa protein cognate 2 OS=Drosophila ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top