FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP75_DROME (Major heat shock 70 kDa protein Bc OS=Drosophila melanogaster GN=Hsp70Bc PE=2 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 9.987e-40
Identity = 82/112 (73.21%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR++ D  +  DMK WPFKV++    KP IGV YKGE K+FA EEISSMVL KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   56 VAMNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSD-GGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNV 166          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP74_DROME (Major heat shock 70 kDa protein Bbb OS=Drosophila melanogaster GN=Hsp70Bbb PE=2 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 9.987e-40
Identity = 82/112 (73.21%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR++ D  +  DMK WPFKV++    KP IGV YKGE K+FA EEISSMVL KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   56 VAMNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSD-GGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNV 166          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP73_DROME (Major heat shock 70 kDa protein Bb OS=Drosophila melanogaster GN=Hsp70Bb PE=2 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 9.987e-40
Identity = 82/112 (73.21%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR++ D  +  DMK WPFKV++    KP IGV YKGE K+FA EEISSMVL KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   56 VAMNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSD-GGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNV 166          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_MOUSE (Heat shock-related 70 kDa protein 2 OS=Mus musculus GN=Hspa2 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 9.987e-40
Identity = 80/112 (71.43%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNT+FD KRLIGR+F DA+VQ DMK WPF+V++    KP + V YKGE K F  EEISSMVL KM+EIAEAYLG  +++AV+TVPAYFNDSQRQATKDAG I GLNV
Sbjct:   60 VAMNPTNTIFDRKRLIGRKFEDATVQSDMKHWPFRVVS-EGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNV 170          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_DROSI (Major heat shock 70 kDa protein Ba OS=Drosophila simulans GN=Hsp70Ba PE=2 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 9.987e-40
Identity = 82/112 (73.21%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR++ D  +  DMK WPFKV++    KP IGV YKGE K+FA EEISSMVL KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   56 VAMNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSD-CGKPKIGVEYKGESKRFAPEEISSMVLAKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNV 166          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_DROME (Major heat shock 70 kDa protein Ba OS=Drosophila melanogaster GN=Hsp70Ba PE=2 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 9.987e-40
Identity = 82/112 (73.21%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR++ D  +  DMK WPFKV++    KP IGV YKGE K+FA EEISSMVL KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   56 VAMNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSD-GGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNV 166          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_SCHPO (Probable heat shock protein ssa1 OS=Schizosaccharomyces pombe GN=ssa1 PE=1 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 9.987e-40
Identity = 83/112 (74.11%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NT+FDAKRLIGRRF+D  VQ DMK WPFKVI     KP+I V +KGE K F  EEISSMVL+KMRE AEA+LG  + +AVVTVPAYFNDSQRQATKDAG+IAGLNV
Sbjct:   57 VAMNPHNTIFDAKRLIGRRFNDPEVQSDMKHWPFKVIEKDG-KPLIQVEFKGETKTFTPEEISSMVLLKMRESAEAFLGGKVTDAVVTVPAYFNDSQRQATKDAGLIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_DROSI (Major heat shock 70 kDa protein Ab OS=Drosophila simulans GN=Hsp70Ab PE=2 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 9.987e-40
Identity = 81/112 (72.32%), Postives = 93/112 (83.04%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR++ D  +  D+K WPFKV++    KP IGV YKGE K+FA EEISSMVL+KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   56 VAMNPRNTVFDAKRLIGRKYDDPKIAEDIKHWPFKVVSD-GGKPKIGVEYKGESKRFAPEEISSMVLVKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNV 166          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_DROME (Major heat shock 70 kDa protein Ab OS=Drosophila melanogaster GN=Hsp70Ab PE=1 SV=3)

HSP 1 Score: 161.77 bits (408), Expect = 9.987e-40
Identity = 82/112 (73.21%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR++ D  +  DMK WPFKV++    KP IGV YKGE K+FA EEISSMVL KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   56 VAMNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSD-GGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNV 166          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_THEAN (Heat shock 70 kDa protein OS=Theileria annulata GN=TA11610 PE=3 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 9.987e-40
Identity = 79/111 (71.17%), Postives = 92/111 (82.88%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A NP NT+FDAKRLIGR+F D +VQ DMK WPFKV  GP  KP I V ++GE+K F AEEISSMVL KM+EIAE++LG ++K+ V+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   59 ARNPENTIFDAKRLIGRKFDDRTVQEDMKHWPFKVTNGPNGKPNIEVTFQGEKKTFHAEEISSMVLTKMKEIAESFLGKSVKDVVITVPAYFNDSQRQATKDAGTIAGLNV 169          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP75_DROME9.987e-4073.21Major heat shock 70 kDa protein Bc OS=Drosophila m... [more]
HSP74_DROME9.987e-4073.21Major heat shock 70 kDa protein Bbb OS=Drosophila ... [more]
HSP73_DROME9.987e-4073.21Major heat shock 70 kDa protein Bb OS=Drosophila m... [more]
HSP72_MOUSE9.987e-4071.43Heat shock-related 70 kDa protein 2 OS=Mus musculu... [more]
HSP72_DROSI9.987e-4073.21Major heat shock 70 kDa protein Ba OS=Drosophila s... [more]
HSP72_DROME9.987e-4073.21Major heat shock 70 kDa protein Ba OS=Drosophila m... [more]
HSP71_SCHPO9.987e-4074.11Probable heat shock protein ssa1 OS=Schizosaccharo... [more]
HSP71_DROSI9.987e-4072.32Major heat shock 70 kDa protein Ab OS=Drosophila s... [more]
HSP71_DROME9.987e-4073.21Major heat shock 70 kDa protein Ab OS=Drosophila m... [more]
HSP70_THEAN9.987e-4071.17Heat shock 70 kDa protein OS=Theileria annulata GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top