FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_DROME (Major heat shock 70 kDa protein Aa OS=Drosophila melanogaster GN=Hsp70Aa PE=2 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 9.987e-40
Identity = 82/112 (73.21%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR++ D  +  DMK WPFKV++    KP IGV YKGE K+FA EEISSMVL KM+E AEAYLG +I +AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   56 VAMNPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSD-GGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNV 166          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS71L_MACFA (Heat shock 70 kDa protein 1-like OS=Macaca fascicularis GN=HSPA1L PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 9.987e-40
Identity = 83/112 (74.11%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F+D  VQ DMKLWPF+VI     KP + V+YKGE K F  EEISSMVL KM+E AEA+LG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   61 VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVI-NEGGKPKVLVSYKGENKAFYPEEISSMVLTKMKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_ORYLA (Heat shock cognate 71 kDa protein OS=Oryzias latipes GN=hsc70 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.704e-39
Identity = 82/112 (73.21%), Postives = 89/112 (79.46%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGRRF D  VQ DM  WPF VI     +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAV+TVPAYFNDSQRQATKDAG I+GLNV
Sbjct:   59 VAMNPTNTVFDAKRLIGRRFDDHVVQSDMNDWPFNVI-NDNTRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_CANAL (Heat shock protein SSA2 OS=Candida albicans GN=SSA2 PE=1 SV=3)

HSP 1 Score: 160.614 bits (405), Expect = 2.225e-39
Identity = 82/111 (73.87%), Postives = 92/111 (82.88%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            AMNP NTVFDAKRLIGR+F D  VQGD+K +PFKV+   A KPMI V YKGE K F+ EEISSM+L KM+E AE +LG T+K+AVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   58 AMNPANTVFDAKRLIGRKFDDHEVQGDIKHFPFKVV-DKASKPMIQVEYKGETKTFSPEEISSMILGKMKETAEGFLGTTVKDAVVTVPAYFNDSQRQATKDAGTIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_CLAHE (Heat shock 70 kDa protein OS=Cladosporium herbarum GN=HSP70 PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 2.225e-39
Identity = 82/112 (73.21%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA+NP NTVFDAKRLIGR+F DA VQ DMK +PFKVI   A KP+  V +KGE K F  EEISSM+L KMRE AE+YLG T+ NAV+TVPAYFNDSQRQATKDAG+IAGLNV
Sbjct:   57 VAINPHNTVFDAKRLIGRKFQDAEVQADMKHFPFKVIE-KAGKPVTQVEFKGETKDFTPEEISSMILTKMRETAESYLGGTVNNAVITVPAYFNDSQRQATKDAGLIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS71L_HUMAN (Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 2.225e-39
Identity = 82/112 (73.21%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F+D  VQ DMKLWPF+VI     KP + V+YKGE K F  EEISSMVL K++E AEA+LG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   61 VAMNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVI-NEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_CERAE (Heat shock 70 kDa protein 1 OS=Cercopithecus aethiops GN=HSPA1 PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 2.906e-39
Identity = 83/112 (74.11%), Postives = 91/112 (81.25%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAEA LG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   59 VALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVI-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEADLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_NEUCR (Heat shock 70 kDa protein OS=Neurospora crassa GN=hsps-1 PE=2 SV=2)

HSP 1 Score: 160.229 bits (404), Expect = 2.906e-39
Identity = 83/112 (74.11%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+FSD  VQ DMK +PFKVI     KP+I V +KGE K F  EEIS+M+L KM+E AEAYLG T+ NAVVTVPAYFNDSQRQATKDAG+IAGLNV
Sbjct:   57 VAMNPANTVFDAKRLIGRKFSDPEVQADMKHFPFKVI-DRGGKPVIQVEFKGETKVFTPEEISAMILQKMKETAEAYLGGTVNNAVVTVPAYFNDSQRQATKDAGLIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP76_SAGOE (Heat shock 70 kDa protein 6 OS=Saguinus oedipus GN=HSPA6 PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 3.795e-39
Identity = 79/111 (71.17%), Postives = 94/111 (84.68%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP NTVFDAKRLIGR+F+DA+VQ DMK WPF+V++    KP + V+Y+GE+K F  EEISSMVL KM+E AEAYLG  +K+AV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   62 ALNPLNTVFDAKRLIGRKFADATVQADMKHWPFQVVSEGC-KPKVRVSYRGEDKSFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_XENLA (Heat shock 70 kDa protein OS=Xenopus laevis PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 3.795e-39
Identity = 80/112 (71.43%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F+D  VQ D+K WPF+V++    KP + V YKGEEK F  EEISSMVL KM+E AEAYLG  + NAV+TVPAYFNDSQRQATKDAGV+AGLN+
Sbjct:   60 VAMNPQNTVFDAKRLIGRKFNDPVVQCDLKHWPFQVVSDEG-KPKVKVEYKGEEKSFFPEEISSMVLTKMKETAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVLAGLNI 170          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP70_DROME9.987e-4073.21Major heat shock 70 kDa protein Aa OS=Drosophila m... [more]
HS71L_MACFA9.987e-4074.11Heat shock 70 kDa protein 1-like OS=Macaca fascicu... [more]
HSP7C_ORYLA1.704e-3973.21Heat shock cognate 71 kDa protein OS=Oryzias latip... [more]
HSP72_CANAL2.225e-3973.87Heat shock protein SSA2 OS=Candida albicans GN=SSA... [more]
HSP70_CLAHE2.225e-3973.21Heat shock 70 kDa protein OS=Cladosporium herbarum... [more]
HS71L_HUMAN2.225e-3973.21Heat shock 70 kDa protein 1-like OS=Homo sapiens G... [more]
HSP71_CERAE2.906e-3974.11Heat shock 70 kDa protein 1 OS=Cercopithecus aethi... [more]
HSP70_NEUCR2.906e-3974.11Heat shock 70 kDa protein OS=Neurospora crassa GN=... [more]
HSP76_SAGOE3.795e-3971.17Heat shock 70 kDa protein 6 OS=Saguinus oedipus GN... [more]
HSP70_XENLA3.795e-3971.43Heat shock 70 kDa protein OS=Xenopus laevis PE=2 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top