FC920697

Overview
NameFC920697
Unique NameFC920697
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length741
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15382 contig Ccv1_Contig15382:10..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA5_MACFA (Annexin A5 OS=Macaca fascicularis GN=ANXA5 PE=2 SV=3)

HSP 1 Score: 93.2041 bits (230), Expect = 1.575e-18
Identity = 63/194 (32.47%), Postives = 95/194 (48.97%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEE-LIRILTTRSKAQINATLNHY 673
            DAE L KA +G GT+E  I+++L  R+ AQR+ I   +   +G DLL  L  EL+  FE+ ++         DAY    A K   +   VL EI  +R+  +L A K+ Y   Y  SLE+DV   TSG ++++LV L+   R     ++      +A+ +      K    EE  I I  TRS + +    + Y
Sbjct:   20 DAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIKEVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKY 213          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA1_HORSE (Annexin A1 OS=Equus caballus GN=ANXA1 PE=2 SV=3)

HSP 1 Score: 93.2041 bits (230), Expect = 1.575e-18
Identity = 66/203 (32.51%), Postives = 100/203 (49.26%), Query Frame = 2
Query:   68 PTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHY 673
            P+  PS+  D + LHKA    G +EA II +L  RN AQR+ I+  Y +  G+ L +AL K L+   E   L    TPA  DA     A K L +    L+EI  +R+++++    + Y    K+ L +D+   TSGDF+K L+ L    R +   VN  LA ++A+ + +    +      +   ILTTRS   +      Y
Sbjct:   40 PSFNPSS--DVDALHKAITVKGVDEATIIEILTKRNNAQRQQIKAAYLQEKGKPLDEALKKALTGHLEDVALALLKTPARFDADELRAAMKGLGTDEDTLIEILTSRTNKEIREINRVYREELKRDLAKDITSDTSGDFQKALLSLAKGDRSEDFGVNDDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPHLRRVFQMY 240          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA7_XENLA (Annexin A7 OS=Xenopus laevis GN=anxa7 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.056e-18
Identity = 65/212 (30.66%), Postives = 107/212 (50.47%), Query Frame = 2
Query:   44 STMATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYD-GGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHY 673
            +T  T+K       A  DAE+L KA +G+GT+E  I  V+A+R+  QR+ I+  +   YG+DL+K L  ELS + E  ++   +     DA+    A K   +   VL+EI CTR++ ++      Y   + + +E+D+   TSG F +LL+ +++    D   +VNM  A  +A+ +      K    E     +L +RS  Q+ A    Y
Sbjct:  198 ATQGTIKAAPNF-DALSDAEKLRKAMKGFGTDEKPI-DVVANRSNDQRQKIQAAFKTAYGKDLIKDLKSELSGNVEELIIALFMPSTYYDAWSLYNAMKGAGTQERVLIEILCTRTNSEIRNIVACYKQEFGREIEKDIRSDTSGHFERLLISIMARGIVDESQNVNMQQAEQDAQRLYQAGEGKLGTDESSFNLVLASRSFPQLKAVAEAY 407          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA5_BOVIN (Annexin A5 OS=Bos taurus GN=ANXA5 PE=1 SV=3)

HSP 1 Score: 92.4337 bits (228), Expect = 2.686e-18
Identity = 63/194 (32.47%), Postives = 95/194 (48.97%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEE-LIRILTTRSKAQINATLNHY 673
            DAE L KA +G GT+E  I+++L  R+ AQR+ I   +   +G DLL  L  EL+  FE+ ++         DAY    A K   +   VL EI  +R+  +L A +Q Y   Y  SLE+DV   TSG ++++LV L+   R     ++      +A+ +      K    EE  I I  TRS + +    + Y
Sbjct:   20 DAETLRKAMKGLGTDEETILTLLTSRSNAQRQEIAVAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIEQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDARIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKY 213          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA5_MOUSE (Annexin A5 OS=Mus musculus GN=Anxa5 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.508e-18
Identity = 67/211 (31.75%), Postives = 101/211 (47.87%), Query Frame = 2
Query:   50 MATLKVPTQTPS--AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEE-LIRILTTRSKAQINATLNHY 673
            MAT    T  P      DAE L KA +G GT+E  I+++L  R+ AQR+ I + +   +G DL+  L  EL+  FE+ ++         DAY    A K   +   VL EI  +R+  +L A KQ Y   Y  +LE+DV   TSG ++++LV L+   R     ++      +A+ +      K    EE  I I  TRS + +    + Y
Sbjct:    1 MATRGTVTDFPGFDGRADAEVLRKAMKGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFGRDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELSAIKQVYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKY 211          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA1_PIG (Annexin A1 OS=Sus scrofa GN=ANXA1 PE=1 SV=3)

HSP 1 Score: 91.6633 bits (226), Expect = 4.581e-18
Identity = 69/208 (33.17%), Postives = 101/208 (48.56%), Query Frame = 2
Query:   68 PTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKII-----RDKISDKDYAHEELIRILTTRSKAQINATLNHYN 676
            PT  PS+  D E  HKA    G +EA II +   R  AQR+ I+  Y +  G+ L +AL K L+   E   L    TPA+ DA     A K L +    L EI  +R++R++    + Y    K+ L +D+   TSGD++K L+ L    R +   +N  LA T+A+ +     R K +D +      I ILTTRS   +      Y+
Sbjct:   40 PTFNPSS--DVEASHKAITVKGVDEATIIEIHTKRTNAQRQQIKAAYLQEKGKPLDEALKKALTGHLEEVALALLKTPAQFDADELRAAMKGLGTDEDTLNEILASRTNREIREINRVYKEELKRDLAKDITSDTSGDYQKALLSLAKGDRSEDLAINDDLADTDARALYEAGERRKGTDLNV----FITILTTRSYLHLRRVFQKYS 241          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA2_PONAB (Annexin A2 OS=Pongo abelii GN=ANXA2 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.021e-17
Identity = 63/198 (31.82%), Postives = 98/198 (49.49%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFR-YDGGDVNMMLARTEAKIIRDK-ISDKDYAHEELIRILTTRSKAQINATLNHY 673
            A  DA  +  A +  G +E  I+++L +R+ AQR+ I   Y     ++L  AL   LS   E  +L    TPA+ DA     + K L +    L+EI C+R++++L    + Y   YK  LE+D+   TSGDFRKL+V L    R  DG  ++  L   +A+ + D  +  K     + I I+T RS   +    + Y
Sbjct:   35 AERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRY 232          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA2_HUMAN (Annexin A2 OS=Homo sapiens GN=ANXA2 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 1.021e-17
Identity = 63/198 (31.82%), Postives = 98/198 (49.49%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFR-YDGGDVNMMLARTEAKIIRDK-ISDKDYAHEELIRILTTRSKAQINATLNHY 673
            A  DA  +  A +  G +E  I+++L +R+ AQR+ I   Y     ++L  AL   LS   E  +L    TPA+ DA     + K L +    L+EI C+R++++L    + Y   YK  LE+D+   TSGDFRKL+V L    R  DG  ++  L   +A+ + D  +  K     + I I+T RS   +    + Y
Sbjct:   35 AERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRY 232          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX10_HUMAN (Annexin A10 OS=Homo sapiens GN=ANXA10 PE=1 SV=3)

HSP 1 Score: 90.5077 bits (223), Expect = 1.021e-17
Identity = 57/199 (28.64%), Postives = 103/199 (51.76%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHYNDAFG 688
            DA+ L  A QG+  ++ ++I++L  R  AQR +I E Y   YG DL+  + ++LS  F+  +      P   DA+    A K + +    L+EI  +R++ ++F  ++AY  +Y  +L+ED+   TSG FR  L+ LV   R + G  +  +A  +A ++ +    K   H+ +++ IL  +S  Q+      + +  G
Sbjct:   22 DAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGDMREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTR-EEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISG 219          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX11_COLLI (Annexin A1 isoform p35 OS=Columba livia GN=CP35 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.333e-17
Identity = 68/227 (29.96%), Postives = 106/227 (46.70%), Query Frame = 2
Query:   41 KSTMATLKVPTQT---PSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDK---------------ISDKDYAHEELIRILTTRSKAQINATLN 667
            K T     VP QT   PSA  D   L KA    G +EA II ++  R  AQR  I+  Y++  G+ L +A+ + L S  E  V+    TPA+ DA       K   +    L+EI  +R+++++  A + Y    K+ L +D+   TSGDF+K LV L    R +   VN  LA  +A+ + +                ++ + Y H E+ +  T  SK  +N  ++
Sbjct:   23 KCTQCVHGVPQQTNFDPSA--DVVALEKAMTAKGVDEATIIDIMTTRTNAQRPRIKAAYHKAKGKSLEEAMKRVLKSHLEDVVVALLKTPAQFDAEELRACMKGHGTDEDTLIEILASRNNKEIREACRYYKEVLKRDLTQDIISDTSGDFQKALVSLAKADRCENPHVNDELAEKDARALYEAGEQKKGTDINVFVTVLTARSYPHSEVFQKYTKYSKHDMNKAVD 247          
The following BLAST results are available for this feature:
BLAST of FC920697 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
ANXA5_MACFA1.575e-1832.47Annexin A5 OS=Macaca fascicularis GN=ANXA5 PE=2 SV... [more]
ANXA1_HORSE1.575e-1832.51Annexin A1 OS=Equus caballus GN=ANXA1 PE=2 SV=3[more]
ANXA7_XENLA2.056e-1830.66Annexin A7 OS=Xenopus laevis GN=anxa7 PE=2 SV=1[more]
ANXA5_BOVIN2.686e-1832.47Annexin A5 OS=Bos taurus GN=ANXA5 PE=1 SV=3[more]
ANXA5_MOUSE3.508e-1831.75Annexin A5 OS=Mus musculus GN=Anxa5 PE=1 SV=1[more]
ANXA1_PIG4.581e-1833.17Annexin A1 OS=Sus scrofa GN=ANXA1 PE=1 SV=3[more]
ANXA2_PONAB1.021e-1731.82Annexin A2 OS=Pongo abelii GN=ANXA2 PE=2 SV=1[more]
ANXA2_HUMAN1.021e-1731.82Annexin A2 OS=Homo sapiens GN=ANXA2 PE=1 SV=2[more]
ANX10_HUMAN1.021e-1728.64Annexin A10 OS=Homo sapiens GN=ANXA10 PE=1 SV=3[more]
ANX11_COLLI1.333e-1729.96Annexin A1 isoform p35 OS=Columba livia GN=CP35 PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011H05EF RVDevelop1 Citrus clementina cDNA clone C32011H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920697 ID=FC920697|Name=FC920697|organism=Citrus clementina|type=EST|length=741bp
GACTGCCTCGTCATTTTCTATTTTACAAAAACGCTGAAACAAATCGACAA
TGGCGACCCTTAAAGTGCCAACCCAGACCCCTTCTGCTGCTGAGGATGCT
GAGCAACTCCACAAAGCCTTCCAAGGATGGGGCACGAATGAGGCCCTCAT
TATATCTGTCTTGGCTCACAGAAATGCAGCTCAGCGCAAGTTGATTCGAG
AAATCTACAACGAAACTTATGGGGAAGACCTTCTTAAAGCACTGGACAAA
GAACTTTCAAGTGACTTTGAGAGATCTGTACTGCTATGGACATTGACTCC
TGCTGAGCGTGATGCTTATTTGGCAAATGAAGCGACAAAGAGATTGACTT
CAAGCAACTGGGTTCTCATGGAAATTGCCTGTACTAGATCTTCAAGAGAC
CTATTTGCTGCAAAGCAGGCCTACCATGCTCGTTACAAGAAATCCCTAGA
GGAAGATGTTGCATATCACACATCTGGGGACTTCCGCAAGCTTTTGGTTC
CTCTTGTGAGCACATTTCGATATGATGGAGGAGATGTGAACATGATGTTG
GCAAGAACTGAGGCTAAGATTATCCGTGACAAGATTTCAGACAAGGATTA
TGCTCATGAGGAGCTTATCAGGATTCTGACTACAAGGAGCAAGGCACAGA
TAAATGCGACCCTCAATCACTACAATGATGCTTTTGGAAATGCCATNCAC
AAGGATTTGAAGGCTGATCCCATGATGAATACCTCAACTGC
back to top