FC920697

Overview
NameFC920697
Unique NameFC920697
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length741
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15382 contig Ccv1_Contig15382:10..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA2_RAT (Annexin A2 OS=Rattus norvegicus GN=Anxa2 PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 8.640e-17
Identity = 62/198 (31.31%), Postives = 97/198 (48.99%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFR-YDGGDVNMMLARTEAKIIRDK-ISDKDYAHEELIRILTTRSKAQINATLNHY 673
            A  DA  +  A +  G +E  I+++L +R+ AQR+ I   Y     ++L  A+   LS   E  +L    TPA+ DA     + K L +    L+EI C+R++++L    + Y   YK  LE+D+   TSG+FRKLLV L    R  DG  ++  L   +A+ + D  +  K     + I I+T RS   +      Y
Sbjct:   35 AERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELPSAMKSALSGHLETVMLGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGEFRKLLVALAKGKRAEDGSVIDYELIDQDARELYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERY 232          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX10_DROME (Annexin-B10 OS=Drosophila melanogaster GN=AnnX PE=2 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 8.640e-17
Identity = 63/212 (29.72%), Postives = 104/212 (49.06%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGD--VNMMLARTEAKIIRDKISDKDYAHEELI-RILTTRSKAQINATLNHYNDAFGNAXHKDLK 712
            A++DA+ L  A +G+GT+E  II VL  R+  QR+ I+ +Y   +  DL+  L  EL   FE  ++   + P E      + A   + +    L+EI CT+++ ++      Y  RY++ L E +   TSG FR+LL  +V+  R DG D  V++  A+ +A  +      K    EE+  RI++  S  Q+      Y    G    + +K
Sbjct:   17 ASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQRQTIKAVYEAEFERDLVDDLKDELGGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRPLAEQMCSETSGFFRRLLTLIVTGVR-DGLDTPVDVGQAKEQAAQLYSAGEAKLGTDEEVFNRIMSHASFPQLRLVFEEYKVLSGQTIEQAIK 227          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX2B_XENLA (Annexin A2-B OS=Xenopus laevis GN=anxa2-B PE=2 SV=3)

HSP 1 Score: 82.8037 bits (203), Expect = 2.128e-15
Identity = 60/213 (28.17%), Postives = 103/213 (48.36%), Query Frame = 2
Query:   41 KSTMATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDV--NMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHY 673
            +S + ++K  T    A +DA  +  A +  G +E  II++L +R+  QR+ I   ++    +DL  AL   LS + E  +L    T  + DA     + K L +    L+EI C+R++++L   + AY   +K  LE+D+   TSGDFRKL+V L    R + G++     + +   ++    +  K     + I I+T RS   +      Y
Sbjct:   22 QSKLGSVKAATHF-DAEKDAAAIETAIKTKGVDELTIINILTNRSNEQRQDIAFAFHRRTKKDLPSALKGALSGNLETVMLGLIKTRPQYDASELKASMKGLGTDEDTLIEIICSRTNKELLDIQNAYRELFKTELEKDIMSDTSGDFRKLMVALAKGRRQEDGNMVDYEKIDQDARELYEAGVKRKGTDVTKWITIMTERSHPHLQKVFERY 233          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA1_RODSP (Annexin A1 OS=Rodentia sp. GN=ANXA1 PE=2 SV=3)

HSP 1 Score: 78.9518 bits (193), Expect = 3.073e-14
Identity = 57/203 (28.08%), Postives = 92/203 (45.32%), Query Frame = 2
Query:   68 PTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHY 673
            P+  PS+  D   LHK     G +EA I+ +L  R  AQR  ++ +Y +  GE L + L K L+   +  +L    TPA+ D      A K + +    L+EI  TRS++ +      Y    KK + +     TSG+FR  L+ L    R +   VN  +A T+A+ +      ++     +   ILTT+    +     +Y
Sbjct:   40 PSFDPSS--DVAALHKGIMVNGVDEATILDLLTKRYNAQRHHLKAVYIQETGEPLDETLKKALTGHIQELLLAMIKTPAQFDGNELRAAMKAVGTDEETLIEILWTRSNQQIREITSVYREELKKDIAKYQTSDTSGEFRDALLALAKGNRCEDMSVNQDIADTDARALYQAAERRNGTDVNVFNTILTTKKYPHLRNKFQNY 240          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA9_MOUSE (Annexin A9 OS=Mus musculus GN=Anxa9 PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 1.168e-13
Identity = 66/242 (27.27%), Postives = 107/242 (44.21%), Query Frame = 2
Query:    8 SSFSILQKR*NKSTMATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYD-GGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHY--------NDAFGNAXHKD 706
            SS  +  K     T+ TL+      S  +D ++L KA  G G +   I+ VL +R+  QR+LI   + E   +DLLK+L   LS + E+ V+      A+ DA     A K   S+  V +EI  TR++  L A    Y   ++   EED+   T+G  + LL+ L    R    G ++  L   + + ++   + +     + + +LT RS   +    + Y         DA  N  H D
Sbjct:   18 SSLGLADKTAAWGTLGTLRTFLSF-SVDKDVQRLLKAIAGQGVDYDTIVDVLTNRSREQRQLISRAFQERTKQDLLKSLQAALSGNLEKIVVALLQPAAQFDAQELRTALKTSGSAEDVALEILATRAAPGLQACLAVYKHDFQVEAEEDIRTETNGILQDLLLALSKGDRESYSGIIDYNLEEQDVRALQQ--AGESSTAGQWVLLLTQRSPEHLIRVFDQYRRCTGQELEDAIRNCFHGD 256          
The following BLAST results are available for this feature:
BLAST of FC920697 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
ANXA2_RAT8.640e-1731.31Annexin A2 OS=Rattus norvegicus GN=Anxa2 PE=1 SV=2[more]
ANX10_DROME8.640e-1729.72Annexin-B10 OS=Drosophila melanogaster GN=AnnX PE=... [more]
ANX2B_XENLA2.128e-1528.17Annexin A2-B OS=Xenopus laevis GN=anxa2-B PE=2 SV=... [more]
ANXA1_RODSP3.073e-1428.08Annexin A1 OS=Rodentia sp. GN=ANXA1 PE=2 SV=3[more]
ANXA9_MOUSE1.168e-1327.27Annexin A9 OS=Mus musculus GN=Anxa9 PE=2 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011H05EF RVDevelop1 Citrus clementina cDNA clone C32011H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920697 ID=FC920697|Name=FC920697|organism=Citrus clementina|type=EST|length=741bp
GACTGCCTCGTCATTTTCTATTTTACAAAAACGCTGAAACAAATCGACAA
TGGCGACCCTTAAAGTGCCAACCCAGACCCCTTCTGCTGCTGAGGATGCT
GAGCAACTCCACAAAGCCTTCCAAGGATGGGGCACGAATGAGGCCCTCAT
TATATCTGTCTTGGCTCACAGAAATGCAGCTCAGCGCAAGTTGATTCGAG
AAATCTACAACGAAACTTATGGGGAAGACCTTCTTAAAGCACTGGACAAA
GAACTTTCAAGTGACTTTGAGAGATCTGTACTGCTATGGACATTGACTCC
TGCTGAGCGTGATGCTTATTTGGCAAATGAAGCGACAAAGAGATTGACTT
CAAGCAACTGGGTTCTCATGGAAATTGCCTGTACTAGATCTTCAAGAGAC
CTATTTGCTGCAAAGCAGGCCTACCATGCTCGTTACAAGAAATCCCTAGA
GGAAGATGTTGCATATCACACATCTGGGGACTTCCGCAAGCTTTTGGTTC
CTCTTGTGAGCACATTTCGATATGATGGAGGAGATGTGAACATGATGTTG
GCAAGAACTGAGGCTAAGATTATCCGTGACAAGATTTCAGACAAGGATTA
TGCTCATGAGGAGCTTATCAGGATTCTGACTACAAGGAGCAAGGCACAGA
TAAATGCGACCCTCAATCACTACAATGATGCTTTTGGAAATGCCATNCAC
AAGGATTTGAAGGCTGATCCCATGATGAATACCTCAACTGC
back to top